Cool.Flash.Games

BT种子名称

分享给好友

BT种子基本信息

种子哈希：f2b43a4fcfa9eea3606473b1140c83916d84837e
文档大小：15.5 GB
文档个数：2147个文档
下载次数：1817次
下载速度：极快
收录时间：2024-08-08
最近下载：2025-05-13
DMCA/屏蔽：DMCA/屏蔽

下载磁力链接

magnet:?xt=urn:btih:F2B43A4FCFA9EEA3606473B1140C83916D84837E
复制磁力链接到utorrent、Bitcomet、迅雷、115、百度网盘等下载工具进行下载。

下载BT种子

磁力链接种子下载迅雷下载二维码迅雷看看
磁力链接在线播放？试试百度云网盘离线下载播放！

文档列表

Games/Idle Skilling.swf 57.4 MB
Games/super_chibi_knight.swf 51.3 MB
Games/Road of the Dead 2.swf 44.7 MB
Games/soda_dungeon_lite.swf 44.6 MB
Games/lonewolf.swf 41.8 MB
Games/murder_mystery.swf 41.5 MB
Games/League of Legends Cho'Gath Eats the World.swf 40.8 MB
Games/Tooka Laydee.swf 40.4 MB
Games/the_splitting_chapter_2.swf 39.5 MB
Games/Jo99 games/Krystine and the children in chains.swf 37.7 MB
Games/Faradays Flaw.swf 36.6 MB
Games/Back Door Series/back door 3 - the train.swf 36.5 MB
Games/Tequila Zombies 3.swf 36.4 MB
Games/Brave_Heads.swf 36.2 MB
Games/The Henry Stickmen Collection/fleeing_the_complex.swf 34.5 MB
Games/Echoes Operation Stranglehold.swf 34.0 MB
Games/Whack Series/whack_the_serial_killer_escape_from_torture.swf 34.0 MB
Games/Jo99 games/The mother of the bird men.swf 33.6 MB
Games/The Fancy Pants Adventure World Series/The Fancy Pants Adventure World 3.swf 33.2 MB
Games/Jo99 games/The earl octopusor.swf 33.0 MB
Games/Relive Your Life.swf 32.8 MB
Games/arcuz_ii_dungeons.swf 32.4 MB
Games/astrocreep.swf 32.3 MB
Games/kingdom_rush.swf 32.1 MB
Games/Cuboy Series/Cuboy Cubeture 2.swf 31.7 MB
Games/Dead End St..swf 31.4 MB
Games/shark_lifting_2.swf 31.0 MB
Games/Submachine Series/Submachine 10 the Exit.swf 30.5 MB
Games/sierra_7.swf 29.8 MB
Games/The Henry Stickmen Collection/infiltrating_the_airship.swf 29.8 MB
Games/caravaneer_2.swf 29.4 MB
Games/lab_of_the_dead.swf 29.2 MB
Games/Where is series/where_is_2015.swf 29.0 MB
Games/Cube Escape Series/Cube Escape_ The Cave.swf 28.7 MB
Games/Road Of Heroes.swf 27.8 MB
Games/command_control.swf 27.7 MB
Games/decision_3.swf 27.1 MB
Games/lucky_tower_2.swf 27.0 MB
Games/Gunball Reloaded.swf 26.9 MB
Games/road of the dead.swf 25.7 MB
Games/Back Door Series/back_door-_door_2_the_job.swf 24.9 MB
Games/crystal_story_ii.swf 24.8 MB
Games/mr_vengeance_act_3.swf 24.5 MB
Games/knighttron.swf 24.5 MB
Games/wondrous_lands.swf 24.4 MB
Games/the_bravest_hunter.swf 24.2 MB
Games/dungeon_king.swf 24.1 MB
Games/diseviled_2.swf 24.1 MB
Games/Tactical Assassin Mobile.swf 24.0 MB
Games/Bullet Heaven 2.swf 24.0 MB
Games/Stellar Squad.swf 23.8 MB
Games/Nephis Adventure 2.swf 23.7 MB
Games/min_hero_tower_of_sages.swf 22.9 MB
Games/Raze_3.swf 22.8 MB
Games/Raze.swf 22.8 MB
Games/gretel_and_hansel_2.swf 22.8 MB
Games/zombocalypse_2.swf 22.5 MB
Games/Midnight Cinema.swf 22.3 MB
Games/Dinogen.swf 22.1 MB
Games/digiwoog_disaster.swf 21.6 MB
Games/Sonny_2.swf 21.3 MB
Games/cursed_treasure_2.swf 21.2 MB
Games/The Case of the Mysteriously Missing Hat.swf 20.9 MB
Games/sentryknight2.swf 20.9 MB
Games/arm_of_revenge.swf 20.9 MB
Games/Save To Kill.swf 20.8 MB
Games/valthirian_arc_2.swf 20.8 MB
Games/Symon.swf 20.8 MB
Games/stick_squad_4.swf 20.7 MB
Games/Necronator 2.swf 20.7 MB
Games/Dangerous Adventure 2.swf 20.6 MB
Games/Last Legacy Null Space.swf 20.6 MB
Games/mr_vengeance_act_ii.swf 20.5 MB
Games/Armed With Wings Series/armed_with_wings_3.swf 20.5 MB
Games/Madness Series/Madness Project Nexus mod III.swf 20.5 MB
Games/The Last Door Series/The Last Door - Chapter 3 The Four Witnesses.swf 20.5 MB
Games/Battle of Britain 303 Squadron.swf 20.4 MB
Games/paladog.swf 20.4 MB
Games/goblin_treasure_hunt.swf 20.4 MB
Games/Destination Kepler.swf 20.3 MB
Games/xenos.swf 20.2 MB
Games/Lone Survivor Demo.swf 20.1 MB
Games/pewduckpie_2.swf 20.0 MB
Games/mrbreereturninghome.swf 20.0 MB
Games/Santa rockstar series/Santa Rockstar Metal Xmas 3.swf 20.0 MB
Games/The Last Door Series/The Last Door - Chapter 2 Memories.swf 19.9 MB
Games/incursion_2_the_artifact.swf 19.8 MB
Games/AL Project.swf 19.8 MB
Games/The last stand - Union sity.swf 19.8 MB
Games/Jo99 games/The queen of snakes.swf 19.6 MB
Games/Strike Force Heroes 3.swf 19.4 MB
Games/battleforwaylandkeep.swf 19.4 MB
Games/mr_vengeance_upgrade.swf 19.1 MB
Games/intrusion_2.swf 19.1 MB
Games/Nelly 2 ep.1.swf 19.1 MB
Games/deterministic_dungeon.swf 19.1 MB
Games/freakolantern.swf 19.1 MB
Games/specter_knight.swf 19.0 MB
Games/Robert The Elf.swf 19.0 MB
Games/Cardinal Quest 2.swf 19.0 MB
Games/monster_frontier.swf 18.8 MB
Games/mastermind-world-conqueror.swf 18.8 MB
Games/dragon_age_journeys.swf 18.7 MB
Games/The Sagittarian Series/The Sagittarian 4 Berger.swf 18.6 MB
Games/The Gatekeeper.swf 18.6 MB
Games/strikeforceheroes.swf 18.6 MB
Games/asgard_skill_master.swf 18.6 MB
Games/crystalstory.swf 18.5 MB
Games/Convergence.swf 18.5 MB
Games/stick_squad.swf 18.5 MB
Games/Faint.swf 18.5 MB
Games/LARRY and the GNOMES.swf 18.5 MB
Games/youda_mystery_-_stanwick.swf 18.4 MB
Games/Planet Wars.swf 18.4 MB
Games/riddle_transfer_2.swf 18.4 MB
Games/Madness Series/madness_hydraulic.swf 18.3 MB
Games/love_chase.swf 18.3 MB
Games/Choose Your Weapon Series/Choose Your Weapon 5.swf 18.2 MB
Games/sanguine_2.swf 18.0 MB
Games/super_house_of_dead_ninjas.swf 17.9 MB
Games/Madness Series/madness_accelerant.swf 17.9 MB
Games/Jo99 games/humanoid 47.swf 17.9 MB
Games/sushicatapult.swf 17.9 MB
Games/battle_cry_-_ashes_of_berhyte.swf 17.7 MB
Games/daysofblood.swf 17.6 MB
Games/house_of_fear_revenge.swf 17.6 MB
Games/Personal Trip to the Moon.swf 17.5 MB
Games/Morningstar.swf 17.5 MB
Games/Infectonator Series/infectonator_survivors.swf 17.5 MB
Games/The Lonely Square.swf 17.5 MB
Games/forbiddenarms.swf 17.5 MB
Games/learn to fly 3.swf 17.5 MB
Games/a rabbit fable.swf 17.4 MB
Games/mighty_knight.swf 17.4 MB
Games/Kings Ascent.swf 17.4 MB
Games/undeadend2.swf 17.4 MB
Games/Death Arena Reality Show.swf 17.3 MB
Games/fixation.swf 17.1 MB
Games/Santa rockstar series/Santa Rockstar Metal Xmas 4.swf 17.1 MB
Games/shoot-out_in_the_west.swf 17.1 MB
Games/energy_invaders.swf 17.0 MB
Games/Where is series/where_is_2016.swf 17.0 MB
Games/Battle Of Heroes.swf 17.0 MB
Games/freedomtower2.swf 17.0 MB
Games/frozen_islands_new_horizons.swf 17.0 MB
Games/Skullz.swf 16.9 MB
Games/skydefenderjoesstory.swf 16.8 MB
Games/shoctrooper.swf 16.8 MB
Games/deathcall.swf 16.8 MB
Games/castle_woodwarf.swf 16.7 MB
Games/plantera.swf 16.7 MB
Games/nightmare_in_elmore.swf 16.6 MB
Games/Bear in Super Action Adventure 2.swf 16.6 MB
Games/royal_warfare_2.swf 16.6 MB
Games/Mini Dash.swf 16.5 MB
Games/disaster_will_strike_7.swf 16.5 MB
Games/darksoul.swf 16.5 MB
Games/third_kingdom.swf 16.5 MB
Games/takeover.swf 16.5 MB
Games/cellar_door.swf 16.5 MB
Games/steampunktower.swf 16.4 MB
Games/Lethal RPG War Begins.swf 16.4 MB
Games/The Last Door Series/The Last Door - Chapter 1 The Letter.swf 16.4 MB
Games/Detective Grimoire - The Beginning.swf 16.4 MB
Games/strike_force_heroes_2.swf 16.4 MB
Games/Wheely Series/Wheely 7 Detective.swf 16.3 MB
Games/Shark Series/prehistoricshark.swf 16.3 MB
Games/potheadzombies2.swf 16.3 MB
Games/sacred_treasure.swf 16.3 MB
Games/the_last_dinosaurs.swf 16.2 MB
Games/Stick Squad 2.swf 16.2 MB
Games/memohuntress.swf 16.2 MB
Games/Raze_2.swf 16.2 MB
Games/incursion.swf 16.2 MB
Games/Forgotten Hill Series/Forgotten Hill Surgery.swf 16.2 MB
Games/Clear Vision Series/clear_vision_5.swf 16.0 MB
Games/x-ray_detective.swf 16.0 MB
Games/royal_heroes.swf 15.9 MB
Games/bomber_at_war_2_level_pack.swf 15.9 MB
Games/sentryknight.swf 15.9 MB
Games/Rumble in the Soup.swf 15.7 MB
Games/pause ahead.swf 15.7 MB
Games/riddle_transfer.swf 15.6 MB
Games/epic_war_4.swf 15.6 MB
Games/Madness Series/madness-project_nexus.swf 15.6 MB
Games/stick_squad_3.swf 15.5 MB
Games/amea.swf 15.5 MB
Games/relic.swf 15.5 MB
Games/Astro Teemo.swf 15.5 MB
Player/flashplayer_32_sa.exe 15.5 MB
Games/Hero SimulatorIdle Adventures.swf 15.4 MB
Games/armored_warfare_1917.swf 15.4 MB
Games/planet_noevo_ii.swf 15.4 MB
Games/Castle Wars 2.5.swf 15.4 MB
Games/emit.swf 15.4 MB
Games/a_weekend_at_tweety_s.swf 15.4 MB
Games/Bloons Series/Bloons TD 5.swf 15.4 MB
Games/Whack Series/Whack_The_Thief.swf 15.3 MB
Games/Epic Boss Fighter 2.swf 15.3 MB
Games/onceuponalife.swf 15.3 MB
Games/hippolyta.swf 15.2 MB
Games/bomber_at_war_2_battle_for_resources.swf 15.2 MB
Games/The Enchanted Cave 2.swf 15.1 MB
Games/super_adventure_pals.swf 15.1 MB
Games/tavern_of_heroes.swf 15.1 MB
Games/witchhunt.swf 15.0 MB
Games/zombie_crusade.swf 15.0 MB
Games/mad_day_2.swf 14.9 MB
Games/Right hand.swf 14.9 MB
Games/zos.swf 14.9 MB
Games/That red button..swf 14.9 MB
Games/skypanda.swf 14.8 MB
Games/My Little Army.swf 14.8 MB
Games/The Last Door Series/The Last Door - Chapter 4 Ancient Shadows.swf 14.8 MB
Games/abobosbigadventure.swf 14.7 MB
Games/lostoutpost.swf 14.7 MB
Games/Wheely Series/Wheely 5 Armageddon.swf 14.7 MB
Games/furtivedao.swf 14.7 MB
Games/Zombie And Juliet.swf 14.6 MB
Games/The Henry Stickmen Collection/stealing the diamond.swf 14.6 MB
Games/Riddle School Series/riddle_school_5.swf 14.5 MB
Games/dead paradise 3.swf 14.5 MB
Games/creeping.swf 14.5 MB
Games/attack_of_the_johnnies.swf 14.5 MB
Games/richcars3hustle.swf 14.4 MB
Games/arcuz_behind_the_dark.swf 14.3 MB
Games/Super Crazy Guitar Maniac Deluxe Series/super_crazy_guitar_maniac_deluxe_4.swf 14.2 MB
Games/netherrunner.swf 14.2 MB
Games/Revenge of The Kid.swf 14.2 MB
Games/Tainted Olive - Chapter 2.swf 14.2 MB
Games/warlordsepicconflict.swf 14.2 MB
Games/battlecry.swf 14.1 MB
Games/You're Grounded!.swf 14.1 MB
Games/Ecotone.swf 14.1 MB
Games/royal_warfare.swf 14.0 MB
Games/Loot Heroes Clicker.swf 13.9 MB
Games/tribot fighter.swf 13.9 MB
Games/Trafalgar Origins.swf 13.9 MB
Games/Forgotten Hill Series/Forgotten Hill puppeteer.swf 13.8 MB
Games/epic_battle_fantasy_2.swf 13.8 MB
Games/the_utans_-_defender_of_mavas.swf 13.8 MB
Games/intruder_combat_training_2x.swf 13.8 MB
Games/epic_time_pirates.swf 13.8 MB
Games/Daymare Series/Daymare Town 4.swf 13.8 MB
Games/vi_defenders.swf 13.7 MB
Games/Wheely Series/Wheely 4 Time Travel.swf 13.7 MB
Games/Ching Chong Beautiful.swf 13.7 MB
Games/Monster Detective.swf 13.6 MB
Games/legionofredwolves.swf 13.6 MB
Games/Robots Continue Work Sequence.swf 13.6 MB
Games/call_of_sword.swf 13.6 MB
Games/immortal_souls_dark_crusade.swf 13.6 MB
Games/rearmed_trials.swf 13.6 MB
Games/Pragaras.swf 13.5 MB
Games/gentlegravity.swf 13.5 MB
Games/frantic 3.swf 13.5 MB
Games/reverie.swf 13.5 MB
Games/Earth Taken 3.swf 13.5 MB
Games/royalsquad.swf 13.5 MB
Games/Tequila_Zombies_2.swf 13.4 MB
Games/Urbex.swf 13.4 MB
Games/diseviled.swf 13.4 MB
Games/1 screen hero.swf 13.4 MB
Games/Nayas Quest.swf 13.3 MB
Games/war_zomb_avatar.swf 13.2 MB
Games/legend_of_johnny.swf 13.2 MB
Games/caribbean_admiral_2.swf 13.2 MB
Games/arcalona.swf 13.2 MB
Games/Royal Protectors.swf 13.2 MB
Games/Decision 2.swf 13.2 MB
Games/Vortex Point Series/Vortex Point 7.swf 13.2 MB
Games/Dangerous adventure.swf 13.2 MB
Games/Tip of the Tongue.swf 13.2 MB
Games/Cyber Chaser Counterthrust.swf 13.1 MB
Games/freeway fury 3.swf 13.1 MB
Games/Deep Sleep Series/The Deepest Sleep.swf 13.1 MB
Games/dirt_showdown.swf 13.1 MB
Games/ZS Dead Detective Series/Zombie Society - Death after death 13.swf 13.1 MB
Games/house_of_wolves.swf 13.1 MB
Games/utopianmining.swf 13.1 MB
Games/carrot_fantasy_extreme.swf 13.0 MB
Games/vilesteel.swf 13.0 MB
Games/Rawr.swf 13.0 MB
Games/epic_war_3.swf 13.0 MB
Games/westerado.swf 12.9 MB
Games/The Several Journeys of Reemus Chapter 1.swf 12.9 MB
Games/Cuboy Series/backtothecubeture1.swf 12.9 MB
Games/Thing-Thing Series/thing-thing_arena_classic.swf 12.9 MB
Games/Nano Kingdoms.swf 12.9 MB
Games/Smells Like Art.swf 12.9 MB
Games/civilization_wars_4_monsters.swf 12.9 MB
Games/Dark Cut 3.swf 12.8 MB
Games/Run3.swf 12.8 MB
Games/hordesandlords.swf 12.8 MB
Games/3 Pandas Series/3 Pandas in Brazil.swf 12.8 MB
Games/Kingdom of Liars 3.swf 12.8 MB
Games/The Cave of Ātman.swf 12.8 MB
Games/Band Of Heroes.swf 12.8 MB
Games/enolaprelude.swf 12.7 MB
Games/Nick Toldy and the Legend of Dragon Peninsula.swf 12.7 MB
Games/Back Door Series/back_door-_door_1_the_call.swf 12.6 MB
Games/missioninspacethelostcolony.swf 12.6 MB
Games/The Fabulous Screech.swf 12.6 MB
Games/berzerk_ball_2.swf 12.5 MB
Games/Into_Space_2.swf 12.5 MB
Games/dead paradise 2.swf 12.5 MB
Games/maplewood_junior_high.swf 12.5 MB
Games/Doppelgänger.swf 12.5 MB
Games/BLACK IV.swf 12.5 MB
Games/monsterstd2.swf 12.5 MB
Games/monstersaga.swf 12.5 MB
Games/Robokill 2-Leviatan Five.swf 12.4 MB
Games/Legend of the Void.swf 12.4 MB
Games/bloomo_a_submarine_adventure.swf 12.4 MB
Games/Thing-Thing Series/thing-thing_arena_pro.swf 12.4 MB
Games/Deep Sleep Series/deeper sleep.swf 12.4 MB
Games/Smash_Palace.swf 12.4 MB
Games/farm-express.swf 12.4 MB
Games/chaos_faction_2.swf 12.3 MB
Games/Ray Ardent Science Ninja.swf 12.3 MB
Games/idlers_and_dungeons.swf 12.3 MB
Games/Skip Around the World - India.swf 12.3 MB
Games/3 Pandas Series/3 Pandas in Fantasy.swf 12.3 MB
Games/Zombotron 2 Time Machine.swf 12.2 MB
Games/asgard_story.swf 12.2 MB
Games/super_castle_sprint.swf 12.2 MB
Games/dynasty_war.swf 12.2 MB
Games/mr_vengeance_act-i.swf 12.2 MB
Games/Crazy Christmas.swf 12.2 MB
Games/empiresofarkeia.swf 12.2 MB
Games/Snail Bob Series/snail_bob_8 Island Story.swf 12.1 MB
Games/Covert Front Series/covert_front_4.swf 12.1 MB
Games/Zombotron 2.swf 12.1 MB
Games/gentlemens_club.swf 12.1 MB
Games/Shark Series/newyorkshark.swf 12.1 MB
Games/mega_mechs_2.swf 12.0 MB
Games/Tammy Jo Superstar.swf 12.0 MB
Games/Vortex Point Series/Vortex Point 5 - Monster Movie.swf 12.0 MB
Games/band_of_heroes_might_and_pillage.swf 12.0 MB
Games/Home Sheep Home Series/Home_Sheep_Home_2_Lost_In_London.swf 12.0 MB
Games/storm_ops_3.swf 12.0 MB
Games/Forgotten Hill Series/Forgotten Hill. Memento Playground.swf 12.0 MB
Games/Home Sheep Home Series/home_sheep_home_2_lost_in_space.swf 11.9 MB
Games/Amigo Pancho Series/Amigo Pancho 5_ Arctic and Peru.swf 11.9 MB
Games/blueprint3d.swf 11.9 MB
Games/Quietus.swf 11.9 MB
Games/A House in California.swf 11.9 MB
Games/Ode To Pixel Days.swf 11.8 MB
Games/Home Sheep Home Series/home_sheep_home_2_lost_underground.swf 11.8 MB
Games/Sift Heads Series/sift_heads_cartels_-_act_3.swf 11.8 MB
Games/Ubooly Friends.swf 11.8 MB
Games/The Story of Brewster Chipptooth.swf 11.8 MB
Games/Wheely Series/Wheely 6 Fairytale.swf 11.7 MB
Games/speedrunner.swf 11.7 MB
Games/demonsvsfairyland.swf 11.7 MB
Games/Skip Around the World Finland Suomi.swf 11.7 MB
Games/monster_craft_2.swf 11.7 MB
Games/Dfragmente.swf 11.7 MB
Games/Drunken Assasin.swf 11.7 MB
Games/hero_of_inferno.swf 11.7 MB
Games/dead paradise.swf 11.6 MB
Games/Disaster Will Strike 5.swf 11.6 MB
Games/dead_zed_2.swf 11.6 MB
Games/Bro_vs_Zombie.swf 11.6 MB
Games/give_up_2.swf 11.5 MB
Games/Ossuary The Hodge-Podge Transformer.swf 11.5 MB
Games/No Time to Explain Remastered Demo.swf 11.5 MB
Games/g-switch-3.swf 11.5 MB
Games/Tower of Heaven.swf 11.4 MB
Games/escapefrompuppydeathfactory.swf 11.4 MB
Games/PewDuckPie.swf 11.4 MB
Games/Dont Escape 3.swf 11.3 MB
Games/Monster Love.swf 11.3 MB
Games/night_at_the_colosseum.swf 11.3 MB
Games/Zombie_World_Game.swf 11.3 MB
Games/doom_triple_pack.swf 11.2 MB
Games/keeperofthegrove.swf 11.2 MB
Games/StrikeForce Kitty Series/strikeforce_kitty_2.swf 11.2 MB
Games/nomnation.swf 11.2 MB
Games/skyquest.swf 11.1 MB
Games/Decision.swf 11.1 MB
Games/Super Mario 63.swf 11.1 MB
Games/Ms Vision by Proxy.swf 11.1 MB
Games/Vortex Point Series/Vortex Point 6.swf 11.1 MB
Games/piggywiggy3.swf 11.0 MB
Games/Hidden Valley Ninja.swf 11.0 MB
Games/army_of_ages.swf 11.0 MB
Games/crush_the_castle_2.swf 11.0 MB
Games/frozenislands.swf 10.9 MB
Games/stealth_bound_level_pack.swf 10.9 MB
Games/cyberchaser.swf 10.9 MB
Games/coldgrip.swf 10.9 MB
Games/Monster Squad.swf 10.9 MB
Games/The Fog Fall 3.swf 10.9 MB
Games/disasterwillstrike3.swf 10.9 MB
Games/sentry_knight_conquest.swf 10.9 MB
Games/ravencrime.swf 10.8 MB
Games/mineit.swf 10.8 MB
Games/Clear Vision Series/clear_vision_4.swf 10.8 MB
Games/the_splitting.swf 10.8 MB
Games/pocket creatures pvp.swf 10.8 MB
Games/Car Eats Car 3.swf 10.8 MB
Games/install_d.swf 10.7 MB
Games/cardboardboxassembler.swf 10.7 MB
Games/quantum_patrol.swf 10.7 MB
Games/Dont Escape 2.swf 10.7 MB
Games/stormy_castle.swf 10.7 MB
Games/sandsofthecoliseum.swf 10.7 MB
Games/Headless Zombie.swf 10.7 MB
Games/rupertszombiediary.swf 10.7 MB
Games/shapeshifter2.swf 10.6 MB
Games/kickthecritter.swf 10.6 MB
Games/zombiedemolisher.swf 10.6 MB
Games/questopia.swf 10.6 MB
Games/dino_run_enter_planet_d.swf 10.5 MB
Games/zombies in the shadow the saviour act 2.swf 10.5 MB
Games/the_keeper_of_4_elements.swf 10.5 MB
Games/pandauprising.swf 10.5 MB
Games/RAID Mission.swf 10.5 MB
Games/sequester.swf 10.5 MB
Games/parasite strike.swf 10.5 MB
Games/battlepanic.swf 10.5 MB
Games/Eisydian Saga.swf 10.5 MB
Games/Record Tripping.swf 10.5 MB
Games/hetherdale.swf 10.5 MB
Games/gare.swf 10.4 MB
Games/Payphone Mania!.swf 10.4 MB
Games/crush the castle 2 players pack.swf 10.4 MB
Games/damn birds 2.swf 10.4 MB
Games/Project Wasteland 0.swf 10.4 MB
Games/mogo_mogo.swf 10.4 MB
Games/bombrunner.swf 10.4 MB
Games/earth_taken_2.swf 10.4 MB
Games/cactusmccoy2.swf 10.4 MB
Games/Santa rockstar series/Santa Rockstar Metal Xmas 2.swf 10.4 MB
Games/Dragon Boy 2.swf 10.4 MB
Games/Where is series/where_is_2013.swf 10.4 MB
Games/billy_makin_kid.swf 10.4 MB
Games/dragon_fortress.swf 10.4 MB
Games/Symbiosis Greenland.swf 10.4 MB
Games/Tales of Carmelot - The Missing Pot of Gold.swf 10.3 MB
Games/ski_safari.swf 10.3 MB
Games/Excavate!.swf 10.3 MB
Games/royaloffense.swf 10.3 MB
Games/Vorago.swf 10.3 MB
Games/The Grey Rainbow.swf 10.3 MB
Games/Days 2 Die - The Other Side.swf 10.3 MB
Games/Zombinsanity.swf 10.3 MB
Games/gretel and hansel.swf 10.3 MB
Games/Building Rush 2.swf 10.2 MB
Games/muu just another day.swf 10.2 MB
Games/Paladin The Game.swf 10.2 MB
Games/xenosquad.swf 10.2 MB
Games/paladin.swf 10.2 MB
Games/Piece of Princess Cake.swf 10.2 MB
Games/failman.swf 10.2 MB
Games/mr_splibox_2.swf 10.2 MB
Games/armor mayhem.swf 10.2 MB
Games/pheusandmor.swf 10.2 MB
Games/Amigo Pancho Series/Amigo Pancho 3 Sheriff Sancho.swf 10.2 MB
Games/Wilt Last Blossom.swf 10.2 MB
Games/glean.swf 10.2 MB
Games/shadowless.swf 10.1 MB
Games/3 Pandas Series/3 Pandas in Japan.swf 10.1 MB
Games/red_ball_3.swf 10.1 MB
Games/2112_cooperation_series/2112_cooperation_chapter_5.swf 10.1 MB
Games/Alice is dead 3.swf 10.1 MB
Games/Freeway Fury 2.swf 10.1 MB
Games/Crunchdown.swf 10.0 MB
Games/seed of destruction.swf 10.0 MB
Games/art_of_war_omaha.swf 10.0 MB
Games/pirateers.swf 10.0 MB
Games/ray_and_cooper_2.swf 10.0 MB
Games/elite_squad.swf 10.0 MB
Games/skinny.swf 9.9 MB
Games/Knightfall 2.swf 9.9 MB
Games/Snail Bob Series/snail_bob_6_winter_story.swf 9.9 MB
Games/gravity_guy.swf 9.9 MB
Games/pirates of the undead sea.swf 9.9 MB
Games/Shark Series/los_angeles_shark.swf 9.9 MB
Games/loondon.swf 9.9 MB
Games/Zombies in the shadow act 1.swf 9.9 MB
Games/robinsoncrusoe.swf 9.9 MB
Games/slush invaders game.swf 9.9 MB
Games/the_pretender_part_three.swf 9.8 MB
Games/Morbid Chapter 2.swf 9.8 MB
Games/13daysafter.swf 9.8 MB
Games/Alien Anarchy.swf 9.8 MB
Games/stealth_bound.swf 9.8 MB
Games/Monsters Den Chronicles.swf 9.8 MB
Games/The Impossible Quiz 2.swf 9.8 MB
Games/dungeon runner.swf 9.8 MB
Games/vampire skills.swf 9.8 MB
Games/dawn_of_the_sniper_2.swf 9.8 MB
Games/DarkBase 3 - Phoenix Team.swf 9.8 MB
Games/Sonny.swf 9.8 MB
Games/polar tale.swf 9.8 MB
Games/The Fancy Pants Adventure World Series/The Fancy Pants Adventure World 2.swf 9.8 MB
Games/spy car.swf 9.8 MB
Games/pestilence z.swf 9.8 MB
Games/killer_escape.swf 9.8 MB
Games/The Henry Stickmen Collection/escaping_the_prison.swf 9.7 MB
Games/endeavor.swf 9.7 MB
Games/Forgotten Hill Series/forgotten hill fall.swf 9.7 MB
Games/reaching_finality.swf 9.7 MB
Games/Wheely Series/Wheely 3.swf 9.7 MB
Games/Sift Heads Series/sift_heads_street_wars_prologue.swf 9.7 MB
Games/Clear Vision Series/clear_vision_elite.swf 9.7 MB
Games/Snail Bob Series/snail_bob_5 love story.swf 9.7 MB
Games/rizk.swf 9.7 MB
Games/buildup.swf 9.7 MB
Games/tony robinson`s weird world of wonders.swf 9.7 MB
Games/darkbase-2-4033.swf 9.7 MB
Games/dark_base_ii_-_the_hive.swf 9.7 MB
Games/nuclear gun.swf 9.7 MB
Games/sketch_quest.swf 9.7 MB
Games/lucky tower.swf 9.7 MB
Games/mike-shadow-i-paid-for-it.swf 9.7 MB
Games/little_wheel.swf 9.7 MB
Games/draw and fly.swf 9.7 MB
Games/Super Crazy Guitar Maniac Deluxe Series/super_crazy_guitar_maniac_deluxe_3.swf 9.6 MB
Games/Kingdom of Liars 2.swf 9.6 MB
Games/transmorpher2.swf 9.6 MB
Games/Submachine Series/Submachine 9 the Temple.swf 9.6 MB
Games/The Sagittarian Series/the sagittarian 2.swf 9.6 MB
Games/Clear Vision Series/clear_vision_2.swf 9.6 MB
Games/The Guardian Chapter 2 Lantern Of Nightmares.swf 9.6 MB
Games/Daymare Series/Daymare Town 3.swf 9.6 MB
Games/gunball_2_-_emperors_revenge.swf 9.6 MB
Games/mr_splibox_the_christmas_story.swf 9.6 MB
Games/Guitar Geek.swf 9.6 MB
Games/super_battle_city.swf 9.6 MB
Games/Siege Hero Pirate Pillage.swf 9.6 MB
Games/WW2 dogfight age of Warplane.swf 9.6 MB
Games/zombiecats.swf 9.6 MB
Games/Vortex Point Series/VortexPoint4.swf 9.6 MB
Games/loot_hero.swf 9.6 MB
Games/Armed With Wings Series/armed_with_wings_2.swf 9.5 MB
Games/timekiller.swf 9.5 MB
Games/Look_out_Mr_Johnson.swf 9.5 MB
Games/littlewars.swf 9.5 MB
Games/The Body.swf 9.5 MB
Games/zombiesintheshadow.swf 9.5 MB
Games/BNKR.swf 9.5 MB
Games/Cool Story Bro.swf 9.5 MB
Games/rogue_soul_2.swf 9.5 MB
Games/Newtons Law.swf 9.4 MB
Games/A Kitty Dream.swf 9.4 MB
Games/Covert Front Series/Covert Front 3 Night in Zurich.swf 9.4 MB
Games/the scene of the crime golden doll.swf 9.4 MB
Games/deepandblue.swf 9.4 MB
Games/Santa rockstar series/Santa Rockstar Metal Xmas.swf 9.4 MB
Games/overhaul.swf 9.4 MB
Games/Sichiken.swf 9.4 MB
Games/i_saw_her_across_the_world.swf 9.4 MB
Games/Marrakesh Club.swf 9.3 MB
Games/Robo Trobo.swf 9.3 MB
Games/pillow_city.swf 9.3 MB
Games/more_zombies.swf 9.3 MB
Games/zombieoutbreak2.swf 9.3 MB
Games/zombudoy_3_pirates.swf 9.3 MB
Games/running_fred_lite.swf 9.3 MB
Games/Cube Escape Series/Cube Escape_ Birthday.swf 9.3 MB
Games/Killer Escape 2.swf 9.3 MB
Games/the_prince_edward.swf 9.3 MB
Games/catchaduck.swf 9.3 MB
Games/game_over_gopher.swf 9.3 MB
Games/relic_of_war.swf 9.2 MB
Games/NONDEVICER.swf 9.2 MB
Games/solclockworkpart1.swf 9.2 MB
Games/Arsenal 2 Romanov Files.swf 9.2 MB
Games/Red Ball 4 (vol.1).swf 9.2 MB
Games/The Several Journeys of Reemus Chapter 3.swf 9.2 MB
Games/bobtherobber.swf 9.2 MB
Games/hanna in a choppa 2.swf 9.2 MB
Games/Paper Venture.swf 9.2 MB
Games/Anaksha Female Assassin.swf 9.2 MB
Games/bela_kovacs_and_the_trail_of_blood.swf 9.2 MB
Games/Amigo Pancho Series/Amigo Pancho 6.swf 9.2 MB
Games/Headless Zombie 2.swf 9.1 MB
Games/baronsgate2.swf 9.1 MB
Games/Shark Series/medieval shark.swf 9.1 MB
Games/planetjuicer.swf 9.1 MB
Games/bobtherobber2.swf 9.1 MB
Games/earth_taken.swf 9.1 MB
Games/the_breach.swf 9.1 MB
Games/william_and_sly_2.swf 9.1 MB
Games/zombotron.swf 9.1 MB
Games/siegius_arena.swf 9.1 MB
Games/Jo99 games/ilemysterieuse49.swf 9.1 MB
Games/dungeon_clicker.swf 9.1 MB
Games/bazookipocalypse.swf 9.1 MB
Games/let_s_journey_2.swf 9.0 MB
Games/magnetizr.swf 9.0 MB
Games/quake_flash.swf 9.0 MB
Games/qcompressingtheheart.swf 9.0 MB
Games/Armed With Wings Series/armed_with_wings_-_culmination.swf 9.0 MB
Games/ninjaland.swf 9.0 MB
Games/electricboy.swf 9.0 MB
Games/Shark Series/sydneyshark.swf 9.0 MB
Games/mandrake.swf 9.0 MB
Games/Sherlock Holmes 2.swf 9.0 MB
Games/Adam and Eve.swf 8.9 MB
Games/star_cars.swf 8.9 MB
Games/Fire_Catcher.swf 8.9 MB
Games/3 Pandas Series/3 Pandas 2. Night.swf 8.9 MB
Games/Amigo Pancho Series/Amigo Pancho 4.swf 8.9 MB
Games/neil_the_nail.swf 8.9 MB
Games/Zombus.swf 8.9 MB
Games/Gun Mayhem 2More Mayhem.swf 8.9 MB
Games/The Book of Living Magic.swf 8.9 MB
Games/nightlights.swf 8.9 MB
Games/Portal Defenders.swf 8.9 MB
Games/Catastrophe Escape.swf 8.9 MB
Games/mechanicalcommando2.swf 8.9 MB
Games/bobbys_not_so_average_adventure.swf 8.9 MB
Games/huebrix.swf 8.9 MB
Games/johnny_rocketfingers_2.swf 8.9 MB
Games/disasterwillstrike 4. ultimatedisaster.swf 8.8 MB
Games/madburger3.swf 8.8 MB
Games/tinyking.swf 8.8 MB
Games/Sift Heads Series/sift_heads_1_remasterized.swf 8.8 MB
Games/Owl's Nest.swf 8.8 MB
Games/SUPER SMASH FLASH.swf 8.8 MB
Games/The Last Stand 2.swf 8.8 MB
Games/Trapped.swf 8.8 MB
Games/coma.swf 8.8 MB
Games/rich-cars.swf 8.8 MB
Games/skullface.swf 8.8 MB
Games/dead_zed.swf 8.8 MB
Games/max_fury.swf 8.8 MB
Games/quantumzombies.swf 8.8 MB
Games/zombobusterrising.swf 8.8 MB
Games/bloom_defender.swf 8.8 MB
Games/cursed_treasure_lp.swf 8.8 MB
Games/burrito bison revenge.swf 8.7 MB
Games/Persist.swf 8.7 MB
Games/Midnight Spooks.swf 8.7 MB
Games/Whack Series/whack_the_terrorist.swf 8.7 MB
Games/liquid2.swf 8.7 MB
Games/warfare_1944.swf 8.7 MB
Games/Toxers.swf 8.7 MB
Games/Swords and Souls.swf 8.7 MB
Games/Snail Bob Series/snail_bob_7_fantasy_story.swf 8.7 MB
Games/purpleplanet.swf 8.6 MB
Games/Feed Us Series/feed_us_5.swf 8.6 MB
Games/zombobuster.swf 8.6 MB
Games/humaliensbattle2.swf 8.6 MB
Games/2112_cooperation_series/2112_cooperation_chapter_1.swf 8.6 MB
Games/kings_guard.swf 8.6 MB
Games/Sift Heads Series/sift_heads_ultimatum.swf 8.6 MB
Games/the_visit.swf 8.6 MB
Games/Killer Escape 3.swf 8.6 MB
Games/jellygo.swf 8.6 MB
Games/Wheely Series/Wheely 2.swf 8.6 MB
Games/MadBurger_2.swf 8.6 MB
Games/Bazooka Boy Series/Bazooka Boy 3.swf 8.6 MB
Games/siegeknight.swf 8.6 MB
Games/burrito bison.swf 8.5 MB
Games/clicker_troops.swf 8.5 MB
Games/days_of_monsters.swf 8.5 MB
Games/disaster_will_strike_6.swf 8.5 MB
Games/Upgrade Complete 2.swf 8.5 MB
Games/2112_cooperation_series/2112_cooperation_chapter_3.swf 8.5 MB
Games/holdthefort.swf 8.5 MB
Games/richmine2xmaspack.swf 8.5 MB
Games/Sacred Heroes.swf 8.5 MB
Games/flight.swf 8.5 MB
Games/The Several Journeys of Reemus Chapter 4.swf 8.4 MB
Games/howmonica.swf 8.4 MB
Games/faster_than_zombies.swf 8.4 MB
Games/zombudoy.swf 8.4 MB
Games/fishy_waters.swf 8.4 MB
Games/Cardinal Quest.swf 8.4 MB
Games/stupidella.swf 8.4 MB
Games/ragdollachievement2.swf 8.4 MB
Games/madville.swf 8.3 MB
Games/Armed With Wings Series/armed-with-wings.swf 8.3 MB
Games/boompirates.swf 8.3 MB
Games/jellyescape.swf 8.3 MB
Games/mylifeisyours.swf 8.3 MB
Games/Red Code 2.swf 8.3 MB
Games/long_way.swf 8.3 MB
Games/Aqua Boy.swf 8.3 MB
Games/grab_that_grub.swf 8.3 MB
Games/rich-cars-2-adrenaline-rush.swf 8.3 MB
Games/Cinema Madness.swf 8.3 MB
Games/Bad Viking and the Curse of the Mushroom King.swf 8.3 MB
Games/Iron Knight.swf 8.3 MB
Games/Capn Marcela Parrot Charmer.swf 8.3 MB
Games/caribbeanadmiral.swf 8.3 MB
Games/nightflies2.swf 8.3 MB
Games/the_royal_archers.swf 8.3 MB
Games/Midnight Spooks 2.swf 8.2 MB
Games/stealth_hunter_2.swf 8.2 MB
Games/Sushi Cat Series/sushicat2thegreatpurrade.swf 8.2 MB
Games/offspringfling.swf 8.2 MB
Games/elfstory.swf 8.2 MB
Games/the_bank_robber.swf 8.2 MB
Games/The Last Door Series/The Last Door Prologue.swf 8.2 MB
Games/roadz.swf 8.2 MB
Games/mage_runner.swf 8.2 MB
Games/whereismybeard.swf 8.2 MB
Games/tinysasters2.swf 8.2 MB
Games/Cube Escape Series/Cube Escape_ Theatre.swf 8.1 MB
Games/Battle Sails.swf 8.1 MB
Games/aboveaverageguy.swf 8.1 MB
Games/humaliens-battle.swf 8.1 MB
Games/thegolem.swf 8.1 MB
Games/Hobo Series/hobo_5_space_brawl.swf 8.1 MB
Games/Sift Heads Series/sift_heads_world_act_5.swf 8.1 MB
Games/gunshotcowboy.swf 8.1 MB
Games/Sift Heads Series/sift_heads_cartels_-_act_1.swf 8.1 MB
Games/Amigo Pancho Series/Amigo Pancho Death Star.swf 8.1 MB
Games/Whack Series/dont_whack_your_teacher.swf 8.1 MB
Games/Bear in Super Action Adventure.swf 8.1 MB
Games/pourthefish.swf 8.1 MB
Games/baron_s_door.swf 8.0 MB
Games/Reincarnation Series/Reincarnation The Final Happy Hour.swf 8.0 MB
Games/Loot Heroes 2.swf 8.0 MB
Games/loot_heroes_ii.swf 8.0 MB
Games/sandsofdoom.swf 8.0 MB
Games/lineoffire.swf 8.0 MB
Games/pixelescape.swf 8.0 MB
Games/g-switch-2.swf 8.0 MB
Games/Pandesal Boy.swf 8.0 MB
Games/Pour The Fish Level Pack.swf 8.0 MB
Games/Hobo Series/hobo_vs_zombies.swf 8.0 MB
Games/deathlab.swf 8.0 MB
Games/Cursed Treasure Dont Touch My Gems!.swf 8.0 MB
Games/boisdarc.swf 8.0 MB
Games/king_s_rush.swf 8.0 MB
Games/The Fog Fall 4.swf 8.0 MB
Games/3lindgame.swf 8.0 MB
Games/Tainted Olive - Chapter 1.swf 7.9 MB
Games/planet_noevo.swf 7.9 MB
Games/Danger Dungeon.swf 7.9 MB
Games/lee_lee_s_quest_2.swf 7.9 MB
Games/murder.swf 7.9 MB
Games/zombietank.swf 7.9 MB
Games/The Several Journeys of Reemus Chapter 2.swf 7.9 MB
Games/discount mayonnaise.swf 7.9 MB
Games/dragon age legends remix01.swf 7.9 MB
Games/Amigo Pancho Series/Amigo Pancho 7.swf 7.9 MB
Games/swarm_queen.swf 7.9 MB
Games/zombiesintheshadow20todie.swf 7.9 MB
Games/siege hero viking vengeance.swf 7.9 MB
Games/Sift Heads Series/Sift Heads World Act 7 - Ultimatum.swf 7.9 MB
Games/castle_rush.swf 7.9 MB
Games/Bite jacker.swf 7.9 MB
Games/Forgotten Hill Series/Forgotten Hill. Memento buried things.swf 7.9 MB
Games/Kingdom of Liars 1.swf 7.9 MB
Games/Dakota Winchesters Adventures - Part 2 Cactus City.swf 7.8 MB
Games/project alnilam.swf 7.8 MB
Games/Riddle School Series/riddle_school-3.swf 7.8 MB
Games/seedling.swf 7.8 MB
Games/transylvania.swf 7.8 MB
Games/monstercraft.swf 7.8 MB
Games/The Sagittarian Series/The Sagittarian 3.swf 7.8 MB
Games/Toss_the_turtle.swf 7.8 MB
Games/state_of_zombies_3.swf 7.8 MB
Games/Snail Bob Series/snail_bob_3.swf 7.8 MB
Games/dawn_of_the_sniper.swf 7.8 MB
Games/Sift Heads Series/sift_heads_world_act_4.swf 7.8 MB
Games/Feed Us Series/feed_us_-_pirates.swf 7.8 MB
Games/Achilles II Origin of a Legend.swf 7.7 MB
Games/babylon.swf 7.7 MB
Games/gingerbreadcircus3.swf 7.7 MB
Games/Sieger Series/sieger_rebuilt_to_destroy.swf 7.7 MB
Games/good daddy_2.swf 7.7 MB
Games/mafiastories.swf 7.7 MB
Games/Frog Fable.swf 7.7 MB
Games/ZS Dead Detective Series/ZS Dead Detective - A cat's chance in hell.swf 7.7 MB
Games/warlords-2-rise-of-demons.swf 7.7 MB
Games/Paul & Percy.swf 7.7 MB
Games/avengers_global_chaos.swf 7.7 MB
Games/adventuresofvalentin.swf 7.7 MB
Games/3 Pandas Series/3 Pandas.swf 7.7 MB
Games/cyclomaniacsepic.swf 7.6 MB
Games/cursedtreasurelevelpack.swf 7.6 MB
Games/Shift Series/shift freedom.swf 7.6 MB
Games/lakeview_cabin.swf 7.6 MB
Games/the_evening_of_the_son.swf 7.6 MB
Games/The Sun for The Vampire.swf 7.6 MB
Games/Upgrade Complete 3.swf 7.6 MB
Games/baberescue.swf 7.6 MB
Games/rew2.swf 7.5 MB
Games/Vision by Proxy 2nd Ed..swf 7.5 MB
Games/Sieger Series/sieger_-_level_pack.swf 7.5 MB
Games/vex3.swf 7.5 MB
Games/zombiesatemyphone.swf 7.5 MB
Games/Closure.swf 7.5 MB
Games/cyclomaniacs2.swf 7.5 MB
Games/Evilgeddon Spooky Max.swf 7.5 MB
Games/run2livegreatescape.swf 7.5 MB
Games/fractured2.swf 7.5 MB
Games/madeinmafia.swf 7.5 MB
Games/blackwoodprologue.swf 7.5 MB
Games/Kram Keep.swf 7.5 MB
Games/belialchapter2.swf 7.5 MB
Games/Cube Escape Series/Cube Escape_ Seasons.swf 7.5 MB
Games/L.I.F.E..swf 7.5 MB
Games/Back to Zombieland.swf 7.5 MB
Games/Jo and Momo Forest Rush.swf 7.4 MB
Games/Stick of Death.swf 7.4 MB
Games/aurora2.swf 7.4 MB
Games/Earn To Die Series/earn_to_die-2_exodus.swf 7.4 MB
Games/awesome_run_2.swf 7.4 MB
Games/Wheely Series/Wheely 8 Aliens.swf 7.4 MB
Games/battle_stance_human_campaign.swf 7.4 MB
Games/awesome_happy_monster.swf 7.4 MB
Games/teslawarofcurrents.swf 7.4 MB
Games/ZS Dead Detective Series/ZS Dead Detective - Rats in a hole.swf 7.4 MB
Games/awesome_tanks_2.swf 7.4 MB
Games/Vortex Point Series/Vortex Point 3.swf 7.3 MB
Games/Teddys Excellent Adventure.swf 7.3 MB
Games/mrsplibox.swf 7.3 MB
Games/Ultimate Gamer Challenge.swf 7.3 MB
Games/Gun Mayhem Redux.swf 7.3 MB
Games/Sieger Series/sieger_2_age_of_gunpowder.swf 7.3 MB
Games/bitzyblitz.swf 7.2 MB
Games/bearbarians.swf 7.2 MB
Games/the_bearbarians.swf 7.2 MB
Games/Aether.swf 7.2 MB
Games/ZS Dead Detective Series/Zombie Society - Dead Detective.swf 7.2 MB
Games/Infectonator Series/infectonator_2.swf 7.2 MB
Games/Submachine Series/Submachine 8 the Plan.swf 7.2 MB
Games/Hobo Series/hobo_7_Heaven.swf 7.2 MB
Games/Arsenal.swf 7.2 MB
Games/kingsgame.swf 7.2 MB
Games/How Smart Are You.swf 7.2 MB
Games/engage.swf 7.2 MB
Games/abduction.swf 7.2 MB
Games/Thing-Thing Series/thing-thing_3.swf 7.2 MB
Games/themostwantedbandito.swf 7.2 MB
Games/fort blaster ahoy there.swf 7.2 MB
Games/rocketpets.swf 7.1 MB
Games/red-extinction.swf 7.1 MB
Games/A Game About Game Literacy.swf 7.1 MB
Games/BubbleQuod.swf 7.1 MB
Games/Awesome_Pirates.swf 7.1 MB
Games/Sushi Cat Series/sushi_cat_2.swf 7.1 MB
Games/Shotgun_vs_Zombies.swf 7.1 MB
Games/mustache attack.swf 7.1 MB
Games/Time Swap A Look To The Past.swf 7.1 MB
Games/Castle Quest.swf 7.1 MB
Games/let_s_journey.swf 7.1 MB
Games/zomgies2.swf 7.1 MB
Games/thewok.swf 7.0 MB
Games/portal_the_flash_version.swf 7.0 MB
Games/tombdefender.swf 7.0 MB
Games/Forgotten Hill Series/Forgotten Hill. Memento Love Beyond.swf 7.0 MB
Games/mushroom madness 3.swf 7.0 MB
Games/collapseit2.swf 7.0 MB
Games/ZS Dead Detective Series/ZS Dead Detective - A Curse In Disguise.swf 7.0 MB
Games/celsium.swf 7.0 MB
Games/Whack Series/whack_the_creeps.swf 7.0 MB
Games/Hostage_Crisis.swf 7.0 MB
Games/Sift Heads Series/sift_heads_world-act_6.swf 7.0 MB
Games/nelly.swf 7.0 MB
Games/Knightmare_Tower.swf 6.9 MB
Games/chibi_knight.swf 6.9 MB
Games/Puzzatales!.swf 6.9 MB
Games/run_2_live.swf 6.9 MB
Games/zombudoy 2 the holiday.swf 6.9 MB
Games/dummyneverfails2.swf 6.9 MB
Games/6 Differences.swf 6.9 MB
Games/awesomeplanes.swf 6.9 MB
Games/loot_heroes.swf 6.9 MB
Games/Shotfirer.swf 6.9 MB
Games/ZS Dead Detective Series/Dead Detective vs Nine Deaths Cat.swf 6.9 MB
Games/The Great Bazooki.swf 6.9 MB
Games/magic orbs.swf 6.9 MB
Games/Blasting Agent.swf 6.9 MB
Games/adventure_time_-_jumping_finn.swf 6.9 MB
Games/primary.swf 6.8 MB
Games/Kill the Plumber 2.swf 6.8 MB
Games/Blocks With Letters On 4.swf 6.8 MB
Games/Deadly Neighbors 2.swf 6.8 MB
Games/Hobo Series/hobo_6_hell.swf 6.8 MB
Games/Jellydad Hero.swf 6.8 MB
Games/Creepos Tales 2.swf 6.8 MB
Games/The Fog Fall 2.swf 6.8 MB
Games/yves.swf 6.8 MB
Games/cactus-mccoy.swf 6.8 MB
Games/freedom-tower.swf 6.8 MB
Games/Caravaneer.swf 6.7 MB
Games/Thing-Thing Series/Thing-Thing Arena 3.swf 6.7 MB
Games/Vortex Point Series/Vortex Point 8.swf 6.7 MB
Games/Sushi Cat Series/sushi_cat_the_honeymoon.swf 6.7 MB
Games/thepaintgunner.swf 6.7 MB
Games/car eats car 2 deluxe.swf 6.7 MB
Games/car eats car 2.swf 6.7 MB
Games/Viktor the Nth.swf 6.7 MB
Games/notinmydungeon.swf 6.7 MB
Games/turbo kids.swf 6.7 MB
Games/escapefromnightmare.swf 6.7 MB
Games/300milestopigsland.swf 6.7 MB
Games/The_Peacekeeper.swf 6.7 MB
Games/Adventure Story.swf 6.7 MB
Games/epicbattlefantasyadventurestory.swf 6.7 MB
Games/Dont Escape.swf 6.6 MB
Games/nightflies.swf 6.6 MB
Games/Knightfall.swf 6.6 MB
Games/awesome_run.swf 6.6 MB
Games/Zombie_Fight_Club.swf 6.6 MB
Games/creativelycomplicated.swf 6.6 MB
Games/mad-day.swf 6.6 MB
Games/the adventures of dear explorer.swf 6.6 MB
Games/K.O.L.M. 2.swf 6.6 MB
Games/Morbid - Chapter 1.swf 6.6 MB
Games/villainous.swf 6.6 MB
Games/2112_cooperation_series/2112_cooperation_chapter_4.swf 6.6 MB
Games/Daymare Series/daymarecat.swf 6.6 MB
Games/The Farm.swf 6.5 MB
Games/pre-civilization_marble_age.swf 6.5 MB
Games/epic_boss_fighter.swf 6.5 MB
Games/Sneak Thief Series/Sneak Thief 4.swf 6.5 MB
Games/Peacefree Tactical Warfare.swf 6.5 MB
Games/Road Of Fury 2.swf 6.5 MB
Games/Sneak Thief Series/Sneak Thief 5.swf 6.5 MB
Games/alien_transporter.swf 6.5 MB
Games/Amil.swf 6.5 MB
Games/Roly-Poly Series/roly-poly_cannon_bloody_monsters_pack_2.swf 6.5 MB
Games/Casual Space.swf 6.5 MB
Games/Cube Escape Series/Cube Escape_ Case 23.swf 6.5 MB
Games/gangsta_bean.swf 6.4 MB
Games/Alice is dead 2.swf 6.4 MB
Games/Age of Wonder - The Lost Scrolls.swf 6.4 MB
Games/Knights_vs_Zombies.swf 6.4 MB
Games/William and Sly.swf 6.4 MB
Games/ClickPLAY series/clickplayquickfire3.swf 6.4 MB
Games/rockyrider2.swf 6.4 MB
Games/alienhominidxtreme.swf 6.4 MB
Games/Shift Series/Alt Shift Lite Edition.swf 6.4 MB
Games/buildingdemolisher.swf 6.4 MB
Games/commando.swf 6.4 MB
Games/Feed Us Series/feed_us_-_lost_island.swf 6.4 MB
Games/allweneedisbrainlevelpack.swf 6.4 MB
Games/makingmonkeys.swf 6.4 MB
Games/Tower of the Archmage.swf 6.4 MB
Games/accurateboy.swf 6.4 MB
Games/Bigotilyo.swf 6.4 MB
Games/ihave1day.swf 6.4 MB
Games/alaskan-adversary.swf 6.4 MB
Games/Bazooka Boy Series/bazookaboy2.swf 6.4 MB
Games/wolverine_tokyo_fury.swf 6.4 MB
Games/zombie_madness_-_the_awakening.swf 6.3 MB
Games/Barons_Gate.swf 6.3 MB
Games/Hobo Series/hobo_4_total_war.swf 6.3 MB
Games/Snail Bob Series/snail_bob_4_space.swf 6.3 MB
Games/StrikeForce Kitty Series/strikeforce_kitty_league.swf 6.3 MB
Games/Mushroom Madness 2.swf 6.3 MB
Games/aurora.swf 6.3 MB
Games/crystal runner.swf 6.3 MB
Games/shorties_s_kingdom 2.swf 6.2 MB
Games/Beard Guy Goes Surfing.swf 6.2 MB
Games/Red Ball 4 (vol.2).swf 6.2 MB
Games/Super Sneak.swf 6.2 MB
Games/kit and the octopod.swf 6.2 MB
Games/intospace.swf 6.2 MB
Games/Sift Heads Series/sift_heads_world_act_3.swf 6.2 MB
Games/volcania.swf 6.2 MB
Games/ZS Dead Detective Series/ZS Dead Detective - Roving Eyes.swf 6.2 MB
Games/worldofmutants.swf 6.2 MB
Games/Feed Us Series/feed_us_xmas_xpansion.swf 6.2 MB
Games/The Enchanted Cave.swf 6.2 MB
Games/paintworld2.swf 6.2 MB
Games/The Great House Escape.swf 6.2 MB
Games/Riddle School Series/riddle_school_4.swf 6.2 MB
Games/dinopanic.swf 6.2 MB
Games/Mystery IQ Test.swf 6.1 MB
Games/BoxHead Series/boxhead_the_christmas_nightmare.swf 6.1 MB
Games/dinoshift.swf 6.1 MB
Games/retriever.swf 6.1 MB
Games/freeway-fury.swf 6.1 MB
Games/Snail Bob Series/snail_bob_2.swf 6.1 MB
Games/Where is series/where_is_2011.swf 6.1 MB
Games/ZS Dead Detective Series/ZS Dead Detective - Brain Drain.swf 6.1 MB
Games/drawfender.swf 6.1 MB
Games/2112_cooperation_series/2112_cooperation_chapter_2.swf 6.1 MB
Games/Jo99 games/hospital 46.swf 6.1 MB
Games/rot gut.swf 6.1 MB
Games/ZS Dead Detective Series/ZS Dead Detective - Murder Case.swf 6.1 MB
Games/Ricochet Kills Series/ricochet_kills_4.swf 6.1 MB
Games/Hero in the Ocean.swf 6.1 MB
Games/super_muzhik_2.swf 6.1 MB
Games/renegades.swf 6.1 MB
Games/Sift Heads Series/sift_heads_cartels_-_act_2.swf 6.0 MB
Games/Searching for the Elephant.swf 6.0 MB
Games/roll_roll_pirate.swf 6.0 MB
Games/supersantabomber.swf 6.0 MB
Games/Earn To Die Series/earn_to_die_2012_part_2.swf 6.0 MB
Games/City Siege Series/City Siege 3 FUBAR Level Pack.swf 6.0 MB
Games/The Dreamerz.swf 6.0 MB
Games/zombiesincentralpark.swf 6.0 MB
Games/the-gun-game-2.swf 6.0 MB
Games/like_vampire_like_son.swf 6.0 MB
Games/Slime Quest.swf 6.0 MB
Games/Sota.swf 6.0 MB
Games/Amigo Pancho Series/Amigo Pancho.swf 6.0 MB
Games/briker2.swf 6.0 MB
Games/Nevermore 3.swf 6.0 MB
Games/yummynuts2.swf 6.0 MB
Games/ink`s_sleep.swf 6.0 MB
Games/Monster Legions.swf 6.0 MB
Games/ClickPLAY series/clickplayrainbow2.swf 6.0 MB
Games/gun mayhem.swf 6.0 MB
Games/Zombie Typocalypse.swf 6.0 MB
Games/tokyoguineapop.swf 5.9 MB
Games/Frantic 2.swf 5.9 MB
Games/Sift Heads Series/sift_heads_world_act_2.swf 5.9 MB
Games/Retro Unicorn Attack.swf 5.9 MB
Games/dragon_s_gold.swf 5.9 MB
Games/Wrap_Attack.swf 5.9 MB
Games/days 2 die.swf 5.9 MB
Games/The Scorpion Box.swf 5.9 MB
Games/Tiny Dangerous Dungeons.swf 5.9 MB
Games/the_pretender_part_two.swf 5.9 MB
Games/The Next Floor.swf 5.9 MB
Games/evilforest.swf 5.9 MB
Games/zombocalypse.swf 5.9 MB
Games/Meat boy - Map Pack.swf 5.9 MB
Games/13_more_days_in_hell.swf 5.9 MB
Games/bugongo.swf 5.9 MB
Games/flawed_dimension.swf 5.9 MB
Games/disasterwillstrike2.swf 5.9 MB
Games/Awesome Seaquest.swf 5.9 MB
Games/transmorpher.swf 5.9 MB
Games/House of Dead Ninjas.swf 5.9 MB
Games/Get Home.swf 5.9 MB
Games/awesomecars.swf 5.8 MB
Games/robokill_-_titan_prime.swf 5.8 MB
Games/Madness Series/Madness Premeditation.swf 5.8 MB
Games/musequest.swf 5.8 MB
Games/chancealot.swf 5.8 MB
Games/sanguine.swf 5.8 MB
Games/ragdollachievement.swf 5.8 MB
Games/Deadly Venom SA.swf 5.8 MB
Games/magicsteel.swf 5.8 MB
Games/Dangerous Dungeons.swf 5.8 MB
Games/anti_terrorist rush.swf 5.8 MB
Games/The Trader of Stories.swf 5.8 MB
Games/saving the company.swf 5.8 MB
Games/Super Crazy Guitar Maniac Deluxe Series/super_crazy_guitar_maniac_deluxe_2.swf 5.8 MB
Games/wizardwalls.swf 5.8 MB
Games/ZS Dead Detective Series/ZS Dead Detective - Graves Secrets.swf 5.8 MB
Games/Feed Us Series/feed_us_4.swf 5.8 MB
Games/quietus2.swf 5.8 MB
Games/chaos-faction.swf 5.8 MB
Games/Dale & Peakot.swf 5.8 MB
Games/fractured.swf 5.8 MB
Games/experimentalshooter.swf 5.8 MB
Games/flash_s_bounty.swf 5.8 MB
Games/Space Incident.swf 5.7 MB
Games/Hitstick Series/hitstick_rebirth.swf 5.7 MB
Games/awesome_tanks.swf 5.7 MB
Games/4 differences.swf 5.7 MB
Games/Submachine Series/Submachine 7 the Core.swf 5.7 MB
Games/Me and My Dinosaur.swf 5.7 MB
Games/thefirsthero.swf 5.7 MB
Games/Warfare 1917.swf 5.7 MB
Games/Bright In The Screen.swf 5.7 MB
Games/Hobo Series/hobo_3_wanted.swf 5.7 MB
Games/howdareyou.swf 5.7 MB
Games/drawfender_level_pack.swf 5.7 MB
Games/Earn To Die Series/earn_to_die_2012.swf 5.7 MB
Games/nuclearplant.swf 5.7 MB
Games/BoxHead Series/boxhead_biever_and_baby.swf 5.7 MB
Games/Submachine Series/submachine7.swf 5.7 MB
Games/Forgotten Hill Series/Forgotten Hill. Memento run run little horse.swf 5.6 MB
Games/Madness Series/madness-regent.swf 5.6 MB
Games/City Siege Series/City_Siege_4_Alien_Siege.swf 5.6 MB
Games/berzerk_ball.swf 5.6 MB
Games/Berzerk Ball Homerun in Berzerk Land.swf 5.6 MB
Games/The Sniper 2.swf 5.6 MB
Games/Kill the Plumber.swf 5.6 MB
Games/Back in Time 2.swf 5.6 MB
Games/themagneticcat.swf 5.6 MB
Games/diamond_hollow_2.swf 5.6 MB
Games/super-mega-bot.swf 5.6 MB
Games/robots cant think.swf 5.6 MB
Games/rogue-soul.swf 5.6 MB
Games/Sift Heads Series/sift_heads_world_act_1.swf 5.6 MB
Games/red_rogue.swf 5.6 MB
Games/i_dont_even_game.swf 5.6 MB
Games/You Only Live Once.swf 5.6 MB
Games/Dragon Boy.swf 5.6 MB
Games/the scene of the crime.swf 5.5 MB
Games/car eats car.swf 5.5 MB
Games/Meat Boy.swf 5.5 MB
Games/escape_from_26.swf 5.5 MB
Games/ruthless_pandas.swf 5.5 MB
Games/Midnight Hunter.swf 5.5 MB
Games/Avant-Garde.swf 5.5 MB
Games/StrikeForce Kitty Series/strikeforce_kitty_last_stand.swf 5.5 MB
Games/flaming_zombooka_3.swf 5.5 MB
Games/truck_loader_5.swf 5.5 MB
Games/Temple of the Spear.swf 5.5 MB
Games/Transmorpher 3.swf 5.5 MB
Games/A Stroll in Space.swf 5.5 MB
Games/dino run marathon of doom.swf 5.5 MB
Games/snowdrift.swf 5.5 MB
Games/intrusion.swf 5.5 MB
Games/Inquisitive Dave.swf 5.5 MB
Games/Arcane_Weapon.swf 5.5 MB
Games/deadly_venom_3.swf 5.5 MB
Games/mushroomer.swf 5.5 MB
Games/Roly-Poly Series/rolypolyeliminator2.swf 5.5 MB
Games/Brawlin' Sailor.swf 5.5 MB
Games/war_card.swf 5.5 MB
Games/Darktopia.swf 5.5 MB
Games/StormWinds. The Mary Reed Chronicles.swf 5.4 MB
Games/chef_day.swf 5.4 MB
Games/soom.swf 5.4 MB
Games/the_world_s_hardest_game_4.swf 5.4 MB
Games/Red Ball 4 (vol.3).swf 5.4 MB
Games/As I Lay Dying!.swf 5.4 MB
Games/blosics3.swf 5.4 MB
Games/Suspense II.swf 5.4 MB
Games/10morebullets.swf 5.4 MB
Games/Dragon's Quest.swf 5.4 MB
Games/madburger.swf 5.4 MB
Games/allweneedisbrain2.swf 5.4 MB
Games/lasercannon3.swf 5.4 MB
Games/Dakota Winchesters Adventures.swf 5.4 MB
Games/Town of Fears.swf 5.4 MB
Games/the_pretender_part_one.swf 5.4 MB
Games/Farm-Express-3.swf 5.4 MB
Games/kamikazepigs.swf 5.4 MB
Games/crashtv.swf 5.4 MB
Games/zomblast.swf 5.4 MB
Games/learntofly2.swf 5.4 MB
Games/the_gun_game_redux.swf 5.4 MB
Games/Awesome Conquest.swf 5.4 MB
Games/Roads_of_Rome_3.swf 5.4 MB
Games/commit5.swf 5.4 MB
Games/slowandblow.swf 5.3 MB
Games/Submachine Series/Submachine 2 the lighthouse.swf 5.3 MB
Games/a_goody_life.swf 5.3 MB
Games/valthirian-arc.swf 5.3 MB
Games/Wake Up the Box Series/Wake Up the Box 5.swf 5.3 MB
Games/shadow regiment.swf 5.3 MB
Games/Coinbox Hero.swf 5.3 MB
Games/Vehicles Level Pack.swf 5.3 MB
Games/wrath_of_zombies.swf 5.3 MB
Games/dusk.swf 5.3 MB
Games/Flood Runner Series/floodrunner4.swf 5.3 MB
Games/Battalion Vengeance.swf 5.3 MB
Games/themostwantedbandito2.swf 5.2 MB
Games/Thing-Thing Series/Thing-Thing Arena 2.swf 5.2 MB
Games/grannystrikesback.swf 5.2 MB
Games/talesworthadventurethelostartifacts.swf 5.2 MB
Games/aggro.swf 5.2 MB
Games/happydeadfriendsplayerspack.swf 5.2 MB
Games/happydeadfriends.swf 5.2 MB
Games/canyon shooter.swf 5.2 MB
Games/superpuzzleplatformer.swf 5.2 MB
Games/free_icecream.swf 5.2 MB
Games/swiftturn2.swf 5.2 MB
Games/binga.swf 5.2 MB
Games/City Siege Series/city_siege_-_sniper.swf 5.2 MB
Games/Reincarnation Series/Reincarnation The Clergy Of Unholy.swf 5.2 MB
Games/Creepos Tales.swf 5.2 MB
Games/Battalion Ghosts.swf 5.2 MB
Games/Comic_Book_Cody.swf 5.2 MB
Games/Amigo Pancho Series/Amigo Pancho 2 New York Party.swf 5.1 MB
Games/Robokill Trainer.swf 5.1 MB
Games/Hobo Series/hobo_2_prison_brawl.swf 5.1 MB
Games/BoxHead Series/boxhead_the_nightmare.swf 5.1 MB
Games/Laser Cannon 3 Levels Pack.swf 5.1 MB
Games/vexation.swf 5.1 MB
Games/driving_force_2.swf 5.1 MB
Games/ZS Dead Detective Series/ZS Dead Detective - Walls can Bleed.swf 5.1 MB
Games/driving_force.swf 5.1 MB
Games/The Scene of the Crime Dream of Murder.swf 5.1 MB
Games/franknslime.swf 5.1 MB
Games/driving_force_4.swf 5.1 MB
Games/The Valley Rule.swf 5.1 MB
Games/driving_force_3.swf 5.1 MB
Games/blosics2levelpack.swf 5.1 MB
Games/Mafia - The Betrayer.swf 5.1 MB
Games/Vortex Point Series/vortex_point_2.swf 5.1 MB
Games/dangerous treasures.swf 5.1 MB
Games/zombie_incursion.swf 5.1 MB
Games/Smokin Barrels 2.swf 5.1 MB
Games/Mini_Commando.swf 5.1 MB
Games/Cowlorful.swf 5.1 MB
Games/bounzy2.swf 5.1 MB
Games/The Everloom.swf 5.0 MB
Games/concernedjoe.swf 5.0 MB
Games/13 Days in Hell.swf 5.0 MB
Games/Covert Front Series/Covert Front 2 station on the horizon.swf 5.0 MB
Games/alphaland.swf 5.0 MB
Games/Reincarnation Series/Reincarnation ADDO.swf 5.0 MB
Games/alienocalypse.swf 5.0 MB
Games/run_ninja_run_-_unexpected_road.swf 5.0 MB
Games/PaintWorld.swf 5.0 MB
Games/pursuitofhat2.swf 5.0 MB
Games/belialchapter2.5.swf 5.0 MB
Games/binga2.swf 5.0 MB
Games/transformers_escape.swf 5.0 MB
Games/jackoinhell2.swf 5.0 MB
Games/KripperZ.swf 5.0 MB
Games/Hobo Series/hobo.swf 5.0 MB
Games/RocketJump.swf 5.0 MB
Games/ClickPLAY series/clickplay-quickfire 2.swf 5.0 MB
Games/ClickPLAY series/clickplayquickfire1.swf 5.0 MB
Games/defence_of_the_portal.swf 4.9 MB
Games/road of fury.swf 4.9 MB
Games/Wheely Series/Wheely.swf 4.9 MB
Games/Deadly Venom 2 - Origins.swf 4.9 MB
Games/A small talk at the back of beyond.swf 4.9 MB
Games/truckloader4.swf 4.9 MB
Games/Fireboy & Watergirl Series/Fireboy & Watergirl in The Crystal Temple.swf 4.9 MB
Games/Notebook Wars Series/Notebook Space Wars.swf 4.9 MB
Games/Space is Key Christmas.swf 4.9 MB
Games/Defend_Your_Nuts_2.swf 4.9 MB
Games/zombie_pinball.swf 4.9 MB
Games/brave_shorties_2.swf 4.9 MB
Games/doodlegod2.swf 4.9 MB
Games/zombie_train.swf 4.9 MB
Games/The Elephant Collection/this-is-the-only-level 4.swf 4.9 MB
Games/Feed Us Series/feed_us_3.swf 4.9 MB
Games/Prophet.swf 4.9 MB
Games/mushbits2.swf 4.8 MB
Games/Talesworth Arena.swf 4.8 MB
Games/chocolate_rambo.swf 4.8 MB
Games/sticky_ninja_academy.swf 4.8 MB
Games/good daddy.swf 4.8 MB
Games/Sushi Cat Series/sushi_cat.swf 4.8 MB
Games/Sift Heads Series/sift_heads_4.swf 4.8 MB
Games/Infectonator Series/infectonator_hot_chase.swf 4.8 MB
Games/Finding Jacks Treasure.swf 4.8 MB
Games/Roly-Poly Series/Roly-Poly Cannon Bloody Monsters Pack.swf 4.8 MB
Games/City Siege Series/city_siege_3_jungle_siege.swf 4.8 MB
Games/vehicles3cartoons.swf 4.8 MB
Games/gogo gummo down in the dumps.swf 4.8 MB
Games/mushroom madness.swf 4.8 MB
Games/blosics2.swf 4.8 MB
Games/slumdog_billionaire.swf 4.8 MB
Games/firebug2.swf 4.8 MB
Games/The Sagittarian Series/The Sagittarian 4 Bayou.swf 4.8 MB
Games/Hey Wizard!.swf 4.8 MB
Games/collapseit.swf 4.8 MB
Games/zombiesituation.swf 4.8 MB
Games/pothead zombies.swf 4.8 MB
Games/wolverine_mrd_escape.swf 4.8 MB
Games/blym.swf 4.8 MB
Games/dinoshift2.swf 4.8 MB
Games/s_t_a_n_d.swf 4.8 MB
Games/mushbits.swf 4.7 MB
Games/Tequila Zombies.swf 4.7 MB
Games/super_squad.swf 4.7 MB
Games/space oddity 2.swf 4.7 MB
Games/Roads of Rome 2.swf 4.7 MB
Games/Buccaneer!.swf 4.7 MB
Games/The Gentleman.swf 4.7 MB
Games/sas_zombie_assault_2_-_insane_asylum.swf 4.7 MB
Games/zombie_at_the_gates.swf 4.7 MB
Games/Thing-Thing Series/Thing-Thing Arena.swf 4.7 MB
Games/lavaclimber.swf 4.7 MB
Games/frogout.swf 4.7 MB
Games/battle_golf.swf 4.7 MB
Games/mirror.swf 4.7 MB
Games/vehicles2.swf 4.7 MB
Games/air_transporter.swf 4.7 MB
Games/Thing-Thing Series/thing-thing_4.swf 4.7 MB
Games/thebullet.swf 4.7 MB
Games/400_years.swf 4.7 MB
Games/fearless.swf 4.7 MB
Games/Jo99 games/coma45.swf 4.7 MB
Games/zombie_trailer_park.swf 4.7 MB
Games/gunbot.swf 4.7 MB
Games/Cube Escape Series/Cube Escape_ The Mill.swf 4.7 MB
Games/Child of a Witch 1.swf 4.6 MB
Games/youarestillabox.swf 4.6 MB
Games/Level Editor Series/Level Editor 4.swf 4.6 MB
Games/roads_of_rome.swf 4.6 MB
Games/Ricochet Kills Series/ricochet Skull hunter.swf 4.6 MB
Games/a_night_in_crazyville.swf 4.6 MB
Games/Zombie Survival - Outbreak.swf 4.6 MB
Games/Shadez 3 The Moon Miners.swf 4.6 MB
Games/Sieger Series/sieger.swf 4.6 MB
Games/zipzip secret dimension.swf 4.6 MB
Games/deadconvoy.swf 4.6 MB
Games/yummynuts.swf 4.6 MB
Games/Use Boxmen.swf 4.6 MB
Games/balloons_vs_zombies.swf 4.6 MB
Games/BoxHead Series/boxhead_bounty_hunter.swf 4.6 MB
Games/Level Editor Series/level-editor.swf 4.6 MB
Games/viaductdesigner.swf 4.5 MB
Games/Snail Bob Series/snail_bob.swf 4.5 MB
Games/aetherpunk.swf 4.5 MB
Games/Necronator.swf 4.5 MB
Games/warpgame.swf 4.5 MB
Games/viking-valor.swf 4.5 MB
Games/Deep Sleep Series/deep sleep.swf 4.5 MB
Games/Battalion Skirmish.swf 4.5 MB
Games/lightquest.swf 4.5 MB
Games/diggy.swf 4.5 MB
Games/gingerbread_circus_2.swf 4.5 MB
Games/ClickPLAY series/clickplayrainbow.swf 4.5 MB
Games/Finders Seekers.swf 4.5 MB
Games/demonsdownunder.swf 4.5 MB
Games/cyclomaniacs.swf 4.5 MB
Games/the_last_stand.swf 4.5 MB
Games/abubathealien.swf 4.5 MB
Games/a Trashy Love Story.swf 4.5 MB
Games/insectonator_zombie_mode.swf 4.5 MB
Games/Child of a Witch 3.swf 4.5 MB
Games/sift_renegade.swf 4.4 MB
Games/Notebook Wars Series/notebookwars3.swf 4.4 MB
Games/battalion_commander.swf 4.4 MB
Games/dibbles-2-winter-woe.swf 4.4 MB
Games/sift_renegade_3_expansion_defiance.swf 4.4 MB
Games/space oddity.swf 4.4 MB
Games/snakesquad.swf 4.4 MB
Games/liquid.swf 4.4 MB
Games/zombie balloon heads 2.swf 4.4 MB
Games/Roly-Poly Series/Roly-Poly Cannon 3.swf 4.4 MB
Games/Blobs Story 2.swf 4.4 MB
Games/airbattle2.swf 4.4 MB
Games/Castle Cat 3.swf 4.4 MB
Games/jellytruck.swf 4.4 MB
Games/acornstory.swf 4.4 MB
Games/vex_2.swf 4.4 MB
Games/absorbed_2.swf 4.3 MB
Games/portal2d.swf 4.3 MB
Games/Sherlock Holmes - The Tea Shop Murder Mystery.swf 4.3 MB
Games/Mining_Truck_2_Trolley_Transport.swf 4.3 MB
Games/chief.swf 4.3 MB
Games/Go Go Plant 2.swf 4.3 MB
Games/Lee Lee's Quest.swf 4.3 MB
Games/Pre-Civilization Stone Age.swf 4.3 MB
Games/xmastrollcannon.swf 4.3 MB
Games/xonix3dlevelspack.swf 4.3 MB
Games/Deadly Neighbours.swf 4.3 MB
Games/Child of a Witch 2.swf 4.3 MB
Games/jim_loves_mary_2.swf 4.3 MB
Games/Reincarnation Series/Reincarnation Let The Evil Times Roll.swf 4.3 MB
Games/crazyhand.swf 4.3 MB
Games/santa run 3.swf 4.3 MB
Games/thelegendofthegoldenrobot.swf 4.3 MB
Games/dibbles_3.swf 4.2 MB
Games/Notebook Wars Series/Notebook Space Wars 2.swf 4.2 MB
Games/Roly-Poly Series/roly-polycannon2.swf 4.2 MB
Games/This is not a minimalist game.swf 4.2 MB
Games/franticfrigates.swf 4.2 MB
Games/atomicpuzzle.swf 4.2 MB
Games/Butterfly Fantasy.swf 4.2 MB
Games/Anniversary Game.swf 4.2 MB
Games/focus.swf 4.2 MB
Games/verge.swf 4.2 MB
Games/Dibbles 4 A Christmas Crisis.swf 4.2 MB
Games/Where is series/where_is_2012.swf 4.2 MB
Games/brave_shorties.swf 4.2 MB
Games/Kill Your Nerves.swf 4.2 MB
Games/continuity.swf 4.2 MB
Games/vexation_2.swf 4.2 MB
Games/99 Bricks the Legend of Garry.swf 4.2 MB
Games/Roly-Poly Series/Roly-Poly Monsters.swf 4.2 MB
Games/firebug.swf 4.2 MB
Games/all that matters.swf 4.2 MB
Games/matchdayofthedead.swf 4.2 MB
Games/butterfly_fantasy_3.swf 4.1 MB
Games/Sift Heads Series/sift_heads_assault_3.swf 4.1 MB
Games/maxploder.swf 4.1 MB
Games/birdblast.swf 4.1 MB
Games/yellow_puzzle.swf 4.1 MB
Games/sharp_trigger.swf 4.1 MB
Games/Reincarnation Series/reincarnationatasteofevil.swf 4.1 MB
Games/minicraft.swf 4.1 MB
Games/Cuboy Series/cuboy hot pants.swf 4.1 MB
Games/Slime's Turn.swf 4.1 MB
Games/sift_renegade_3.swf 4.1 MB
Games/roadkill_revenge.swf 4.1 MB
Games/detective_grimoire.swf 4.1 MB
Games/Eastward Quest.swf 4.1 MB
Games/Shifter.swf 4.1 MB
Games/Covert Front Series/covert_front.swf 4.1 MB
Games/Depict1.swf 4.1 MB
Games/fantasy carnage.swf 4.1 MB
Games/rayandcooper.swf 4.1 MB
Games/Nightmares The Adventures Series/nightmares_the_adventure_5.swf 4.0 MB
Games/Infinity Inc.swf 4.0 MB
Games/give_up.swf 4.0 MB
Games/Earn To Die Series/earn_to_die.swf 4.0 MB
Games/vex.swf 4.0 MB
Games/Notebook Wars Series/notebookwars2.swf 4.0 MB
Games/slingfire.swf 4.0 MB
Games/senya_and_oscar_the_fearless_adventure.swf 4.0 MB
Games/CP6.swf 4.0 MB
Games/Boom Town.swf 4.0 MB
Games/You Are A Box.swf 4.0 MB
Games/oneandonestory.swf 4.0 MB
Games/allweneedisbrain.swf 4.0 MB
Games/Earl Grey and This Rupert Guy.swf 4.0 MB
Games/lasttown.swf 4.0 MB
Games/quantumcorps.swf 4.0 MB
Games/Building Rush.swf 4.0 MB
Games/Home Sheep Home Series/Home Sheep Home.swf 4.0 MB
Games/circus.swf 4.0 MB
Games/zombies_vs_penguins.swf 4.0 MB
Games/GregManiacs.swf 4.0 MB
Games/Solipskier.swf 4.0 MB
Games/battleofundermountain.swf 4.0 MB
Games/Jim Loves Mary.swf 4.0 MB
Games/shape_fold_animals.swf 4.0 MB
Games/myfriendpedro.swf 4.0 MB
Games/tinysquad.swf 4.0 MB
Games/thehuntingofthesnark.swf 4.0 MB
Games/idle_sword.swf 4.0 MB
Games/Fireboy & Watergirl Series/fireboy & watergirl 2 in the light temple.swf 4.0 MB
Games/johnny_upgrade.swf 4.0 MB
Games/Sift Heads Series/sift_heads_5.swf 4.0 MB
Games/sas zombie assault 2.swf 4.0 MB
Games/dino run escape extinction.swf 3.9 MB
Games/william_the_conqueror.swf 3.9 MB
Games/Level Editor Series/level_editor_3.swf 3.9 MB
Games/bustabrain2.swf 3.9 MB
Games/sling.swf 3.9 MB
Games/blobescapefromlab16b.swf 3.9 MB
Games/angrychubby.swf 3.9 MB
Games/flamingzombooka2levelpack.swf 3.9 MB
Games/iquitmustdash.swf 3.9 MB
Games/a_second_chance.swf 3.9 MB
Games/jackthezombie.swf 3.9 MB
Games/disasterwillstrike.swf 3.9 MB
Games/billythepilot.swf 3.9 MB
Games/Fireboy & Watergirl Series/fireboy & watergirl in the ice temple.swf 3.9 MB
Games/eleventhhour.swf 3.9 MB
Games/plazma_burst_forward_to_the_past.swf 3.9 MB
Games/StrikeForce Kitty Series/strikeforce_kitty.swf 3.9 MB
Games/Pick & Dig 2.swf 3.9 MB
Games/rew.swf 3.9 MB
Games/Guardian Rock.swf 3.9 MB
Games/Shameless clone 2.swf 3.8 MB
Games/spaceship.swf 3.8 MB
Games/Reincarnation Series/Reincarnation In The Name Of Evil.swf 3.8 MB
Games/Bustabrain.swf 3.8 MB
Games/Puzzle Legends.swf 3.8 MB
Games/flaming_zombooka_2.swf 3.8 MB
Games/Suspense.swf 3.8 MB
Games/e7.swf 3.8 MB
Games/android.swf 3.8 MB
Games/atomicpuzzle2.swf 3.8 MB
Games/egg_knight.swf 3.8 MB
Games/Xonix 3d.swf 3.8 MB
Games/Submachine Series/submachine4-thelab.swf 3.8 MB
Games/ClickPLAY series/clickplaytime-4.swf 3.8 MB
Games/dragon_quest.swf 3.8 MB
Games/ClickPLAY series/clickplaytime-2.swf 3.8 MB
Games/City Siege Series/city_siege_2_-_resort_siege.swf 3.8 MB
Games/Zombiewest_There_and_Back_Again.swf 3.8 MB
Games/zombie_tactics.swf 3.8 MB
Games/floodedvillage.swf 3.8 MB
Games/state_of_zombies_2.swf 3.7 MB
Games/Hitstick Series/Hitstick 5.swf 3.7 MB
Games/pursuitofhat.swf 3.7 MB
Games/Back in Time.swf 3.7 MB
Games/zombie balloon heads Halloween.swf 3.7 MB
Games/The Guardian. Chapter 1.swf 3.7 MB
Games/me and the key.swf 3.7 MB
Games/zomgies.swf 3.7 MB
Games/dummyneverfails.swf 3.7 MB
Games/Small Arms War.swf 3.7 MB
Games/earthbound.swf 3.7 MB
Games/Butterfly fantasy2.swf 3.7 MB
Games/Psychout.swf 3.7 MB
Games/The Elephant Collection/elephant_quest.swf 3.7 MB
Games/Trapped 2.swf 3.7 MB
Games/Theropods.swf 3.7 MB
Games/The Fog Fall.swf 3.7 MB
Games/johnny_rocketfingers.swf 3.6 MB
Games/wickedrider.swf 3.6 MB
Games/zombies_inc.swf 3.6 MB
Games/bonsai_worlds.swf 3.6 MB
Games/Sugar, Sugar - The Christmas Special.swf 3.6 MB
Games/kleinecastle.swf 3.6 MB
Games/doodle_devil.swf 3.6 MB
Games/Understanding Games Episode 4.swf 3.6 MB
Games/Vortex Point Series/Vortex Point.swf 3.6 MB
Games/belial_chapter_1.swf 3.6 MB
Games/Sift Heads Series/sift_heads_2.swf 3.6 MB
Games/anika_s_odyssey.swf 3.6 MB
Games/Ricochet Kills Series/ricochet_kills_3.swf 3.6 MB
Games/jackoinhell.swf 3.6 MB
Games/A Ghostly Journey.swf 3.6 MB
Games/Rocket Santa 2.swf 3.6 MB
Games/absorbed.swf 3.6 MB
Games/animaloffice.swf 3.6 MB
Games/crush_the_castle_players_pack.swf 3.6 MB
Games/Whack Series/dont_whack_your_boss.swf 3.6 MB
Games/Shift Series/shift_4.swf 3.5 MB
Games/Bloons Series/Bloons 2.swf 3.5 MB
Games/zombiesinyourbackyard.swf 3.5 MB
Games/The Impossible Quiz - Fan Edition.swf 3.5 MB
Games/Stick of Death 2.swf 3.5 MB
Games/Sift Heads Series/sift_heads_assault_2.swf 3.5 MB
Games/Escape from Jay is Games.swf 3.5 MB
Games/Tickets 4Love.swf 3.5 MB
Games/me and the key 2.swf 3.5 MB
Games/Bat Country.swf 3.5 MB
Games/the-illusionists-dream.swf 3.5 MB
Games/frantic.swf 3.5 MB
Games/Shark Series/miamishark.swf 3.5 MB
Games/Big Pixel Zombies.swf 3.5 MB
Games/recursion.swf 3.5 MB
Games/Boss 101.swf 3.5 MB
Games/supervillainy.swf 3.5 MB
Games/warface.swf 3.5 MB
Games/Flood Runner Series/flood_runner_armageddon.swf 3.5 MB
Games/Whack Series/whack_your_boss_17ways.swf 3.5 MB
Games/Ragdoll Cannon Series/ragdollcannon4.swf 3.5 MB
Games/Dummy Never Fails Community.swf 3.4 MB
Games/unfreezeme2.swf 3.4 MB
Games/ageofwonder.swf 3.4 MB
Games/Balls in Space.swf 3.4 MB
Games/Pretentious Game Series/Pretentious Game 5.swf 3.4 MB
Games/zombie balloon heads 3.swf 3.4 MB
Games/Fortune Hunter Wrath of Anubis.swf 3.4 MB
Games/Pick & Dig 3.swf 3.4 MB
Games/Hitstick Series/hitstick6.swf 3.4 MB
Games/catastrophi.swf 3.4 MB
Games/canabalt.swf 3.4 MB
Games/thecompanyofmyself.swf 3.4 MB
Games/montreal mobility.swf 3.4 MB
Games/Hitstick Series/Hitstick 4 International Killer.swf 3.4 MB
Games/agentb10 3.swf 3.4 MB
Games/Feed Us Series/feed_us_2.swf 3.4 MB
Games/lab.swf 3.4 MB
Games/Monsterland Series/Monsterland 4. One more Junior.swf 3.4 MB
Games/katwalk.swf 3.4 MB
Games/Galaxy Jumper.swf 3.3 MB
Games/The Elephant Collection/Achievement Unlocked 2.swf 3.3 MB
Games/Choose Your Weapon Series/Choose Your Weapon 3.swf 3.3 MB
Games/D-Day Defender.swf 3.3 MB
Games/unfreezeme.swf 3.3 MB
Games/Antichromatic.swf 3.3 MB
Games/caesar_s_day_off.swf 3.3 MB
Games/my_friend_pedro_arena.swf 3.3 MB
Games/Understanding Games Episode 1.swf 3.3 MB
Games/upgradecomplete.swf 3.3 MB
Games/adagio.swf 3.3 MB
Games/counter_terror.swf 3.3 MB
Games/levelup.swf 3.3 MB
Games/Monsterland Series/Monsterland 3. Junior Returns.swf 3.3 MB
Games/Alice is dead.swf 3.3 MB
Games/City Siege Series/city_siege.swf 3.3 MB
Games/rollintot.swf 3.2 MB
Games/adralienday.swf 3.2 MB
Games/fancy_snowboarding.swf 3.2 MB
Games/Hummingbird Mind.swf 3.2 MB
Games/angelofthebattlefield2.swf 3.2 MB
Games/Submachine Series/Submachine 6 the edge.swf 3.2 MB
Games/Dogfight 2.swf 3.2 MB
Games/sheriffchase.swf 3.2 MB
Games/60s to Save the Queen.swf 3.2 MB
Games/lasercannon.swf 3.2 MB
Games/sift_renegade_2.swf 3.2 MB
Games/Hitstick Series/hitstick3.swf 3.2 MB
Games/Ricochet Kills Series/ricochet kills space.swf 3.2 MB
Games/Why Am I Dead.swf 3.2 MB
Games/The Henry Stickmen Collection/breaking_the_bank.swf 3.2 MB
Games/perspective.swf 3.2 MB
Games/zoo escape 2.swf 3.2 MB
Games/shadez_2_battle_for_earth.swf 3.2 MB
Games/Garden Gnome Carnage.swf 3.2 MB
Games/Red Code.swf 3.2 MB
Games/Deadly Road Trip.swf 3.1 MB
Games/Feed Us Series/feed_us.swf 3.1 MB
Games/Choose Your Weapon Series/choose your weapon1.swf 3.1 MB
Games/mechanicalcommando.swf 3.1 MB
Games/escapetohell.swf 3.1 MB
Games/ClickPLAY series/clickplay3.swf 3.1 MB
Games/zombiesmasher.swf 3.1 MB
Games/ClickPLAY series/clickplaytime-1_0.swf 3.1 MB
Games/wonderputt.swf 3.1 MB
Games/doodle_god.swf 3.1 MB
Games/vehicles.swf 3.1 MB
Games/vertical_drop_heroes.swf 3.1 MB
Games/fig8.swf 3.1 MB
Games/Ultimate Crab Battle.swf 3.1 MB
Games/Plumber Pickle.swf 3.1 MB
Games/automaton.swf 3.1 MB
Games/Ricochet Kills Series/ricochet_kills_3_level_pack.swf 3.1 MB
Games/jake_s_tough_break.swf 3.1 MB
Games/pipe_riders.swf 3.1 MB
Games/anti_terrorist_rush_2.swf 3.0 MB
Games/Diamond Hollow.swf 3.0 MB
Games/Sift Heads Series/sift_heads.swf 3.0 MB
Games/arcs.swf 3.0 MB
Games/infestor.swf 3.0 MB
Games/Compost.swf 3.0 MB
Games/modern_tanks.swf 3.0 MB
Games/zoo escape.swf 3.0 MB
Games/Ricochet Kills Series/ricochet kills siberia.swf 3.0 MB
Games/Nightmares The Adventures Series/nightmares_the_adventures_4_the_stolen_souvenir_of_rob_r.swf 3.0 MB
Games/killbot.swf 2.9 MB
Games/Crow in Hell Series/crow in hell - affliction.swf 2.9 MB
Games/aerorumble.swf 2.9 MB
Games/greenssurviveonlywhenredsdie.swf 2.9 MB
Games/Ragdoll Cannon Series/Ragdoll Cannon 2.swf 2.9 MB
Games/santa run 2.swf 2.9 MB
Games/myangel.swf 2.9 MB
Games/paperwars.swf 2.9 MB
Games/Reincarnation Series/reincarnationtheevilnextdoor.swf 2.9 MB
Games/Bloons Series/bloons_tower_defense_4.swf 2.9 MB
Games/Sift Heads Series/sift_heads_assault.swf 2.9 MB
Games/archersoath.swf 2.9 MB
Games/cabbagemaniac.swf 2.9 MB
Games/Why Am I Dead Rebirth.swf 2.9 MB
Games/Clear Vision Series/clear_vision.swf 2.9 MB
Games/Coloruid 2.swf 2.9 MB
Games/gemcaveadventure.swf 2.9 MB
Games/Coloruid.swf 2.9 MB
Games/Bombardment.swf 2.9 MB
Games/Blocks With Letters On.swf 2.8 MB
Games/me-and-the-key-3.swf 2.8 MB
Games/photonbaby.swf 2.8 MB
Games/packupthetoy.swf 2.8 MB
Games/Arcane The Stone Circle Series/Arcane The Stone Circle - Episode 8.swf 2.8 MB
Games/Hitstick Series/Hitstick2.swf 2.8 MB
Games/Cube Escape Series/Cube Escape_ Arles.swf 2.8 MB
Games/themanwiththeinvisibletrousers.swf 2.8 MB
Games/Ragdoll Cannon Series/ragdollcannon3.swf 2.8 MB
Games/airbornewars2.swf 2.8 MB
Games/bazookiasilentaffair.swf 2.8 MB
Games/Blocks With Letters On 3.swf 2.8 MB
Games/Submachine Series/Submachine FLF.swf 2.8 MB
Games/Pretentious Game Series/pretentious_game_4.swf 2.8 MB
Games/Blocks With Letters On 2.swf 2.8 MB
Games/Zombie Survival.swf 2.8 MB
Games/one_chance.swf 2.8 MB
Games/10 Bullets.swf 2.8 MB
Games/assembots.swf 2.8 MB
Games/Submachine Series/Submachine 32 chambers.swf 2.8 MB
Games/Sneak Thief Series/Sneak Thief - prime catch.swf 2.8 MB
Games/dad_n_me.swf 2.8 MB
Games/Nunchuck Charlie A Love Story.swf 2.7 MB
Games/Rock n Risk.swf 2.7 MB
Games/Wake Up the Box Series/wakeupthebox3.swf 2.7 MB
Games/Pick & Dig.swf 2.7 MB
Games/Choose Your Weapon Series/choose your weapon2.swf 2.7 MB
Games/ballsoflife.swf 2.7 MB
Games/Steppenwolf Series/steppenwolf_chapter_6_episode_4.swf 2.7 MB
Games/Bloons Series/bloons_super_monkey.swf 2.7 MB
Games/Dont Look Back.swf 2.7 MB
Games/adam_and_eve_3.swf 2.7 MB
Games/Loved.swf 2.7 MB
Games/adam_and_eve_2.swf 2.7 MB
Games/spikealovestory.swf 2.7 MB
Games/k.o.l.m.swf 2.7 MB
Games/give_up_robot.swf 2.7 MB
Games/zombie balloon heads.swf 2.7 MB
Games/the_great_bathroom_escape.swf 2.7 MB
Games/Reincarnation Series/Reincarnation Riley's Out Again.swf 2.7 MB
Games/Sneak Thief Series/Sneak Thief Triple Trouble.swf 2.7 MB
Games/13worms.swf 2.7 MB
Games/Pipol Smasher.swf 2.7 MB
Games/tower_breaker.swf 2.7 MB
Games/Ricochet Kills Series/ricochet kills 2 players pack.swf 2.7 MB
Games/anbot2.swf 2.7 MB
Games/Level Editor Series/leveleditor2.swf 2.7 MB
Games/BoxHead Series/boxhead_the_zombie_wars.swf 2.6 MB
Games/Gap Monsters.swf 2.6 MB
Games/Shorty Covers.swf 2.6 MB
Games/folds-origamigame.swf 2.6 MB
Games/Roly-Poly Series/ROLY-POLY Eliminator.swf 2.6 MB
Games/Monsterland Series/monsterland 2. junior revenge.swf 2.6 MB
Games/Reincarnation Series/reincarnationallhallowsevil.swf 2.6 MB
Games/Can You Escape Love.swf 2.6 MB
Games/zombies_took_my_daughter.swf 2.6 MB
Games/Raider Episode 1.swf 2.6 MB
Games/moonwaltz.swf 2.6 MB
Games/omnomzombies.swf 2.6 MB
Games/The Adventures of Zomboy.swf 2.6 MB
Games/newspaperboy2.swf 2.6 MB
Games/wearefriends.swf 2.6 MB
Games/Notebook Wars Series/notebookwars.swf 2.6 MB
Games/abovehell.swf 2.6 MB
Games/zombieknight.swf 2.6 MB
Games/Raider Episode 2.swf 2.6 MB
Games/Reincarnation Series/Reincarnation The Backfire Of Hell.swf 2.6 MB
Games/afterglow.swf 2.5 MB
Games/g-switch.swf 2.5 MB
Games/Choose Your Weapon Series/Choose Your Weapon 4.swf 2.5 MB
Games/Pretentious Game Series/pretentiousgame3.swf 2.5 MB
Games/lasercannon2.swf 2.5 MB
Games/pyjaman.swf 2.5 MB
Games/Crow in Hell Series/a crow in hell 3.swf 2.5 MB
Games/airbornewars.swf 2.5 MB
Games/catopult.swf 2.5 MB
Games/The Elephant Collection/Achievement Unlocked.swf 2.5 MB
Games/Dibbles Pro Pack.swf 2.5 MB
Games/Tiny Hawk.swf 2.5 MB
Games/blobsstory.swf 2.5 MB
Games/insidia.swf 2.5 MB
Games/Cuboy Series/cuboy quest 2.swf 2.5 MB
Games/air_pressure.swf 2.5 MB
Games/Cuboy Series/cuboy facebutt.swf 2.5 MB
Games/bossslayer.swf 2.5 MB
Games/Submachine Series/Submachine 5 the root.swf 2.5 MB
Games/The great Attic Escape.swf 2.5 MB
Games/spaceiskey2.swf 2.5 MB
Games/BoxHead Series/boxhead more rooms.swf 2.4 MB
Games/Understanding Games Episode 2.swf 2.4 MB
Games/insectonator.swf 2.4 MB
Games/dibblesforthegreatergood.swf 2.4 MB
Games/Armor_Defence.swf 2.4 MB
Games/Spy 2.swf 2.4 MB
Games/defend_your_cabin.swf 2.4 MB
Games/crumpled.swf 2.4 MB
Games/portalquest.swf 2.4 MB
Games/Cube Escape Series/Cube Escape_ Harvey's Box.swf 2.4 MB
Games/kingsrider.swf 2.4 MB
Games/farm_doggie.swf 2.4 MB
Games/Cube Escape Series/Cube Escape_ The Lake.swf 2.4 MB
Games/theadventuresofred.swf 2.4 MB
Games/Feed Us Series/feedushappy.swf 2.4 MB
Games/mouse and guns.swf 2.4 MB
Games/2012shelter.swf 2.4 MB
Games/square_hero_origins.swf 2.4 MB
Games/oilnight.swf 2.4 MB
Games/the_worlds_hardest_game_v_2_0.swf 2.4 MB
Games/trophiends.swf 2.4 MB
Games/asleep walking.swf 2.4 MB
Games/castle cat.swf 2.4 MB
Games/anbot.swf 2.3 MB
Games/Crayon Poke.swf 2.3 MB
Games/Crush_the_castle.swf 2.3 MB
Games/wheniwasyoung.swf 2.3 MB
Games/Sneak Thief Series/Sneak Thief 2.swf 2.3 MB
Games/mirror_runners.swf 2.3 MB
Games/bomb diver.swf 2.3 MB
Games/bamboodino.swf 2.3 MB
Games/Steppenwolf Series/steppenwolf_chapter_6_episode_1.swf 2.3 MB
Games/lancelost.swf 2.3 MB
Games/iq_ball.swf 2.3 MB
Games/soldierdiary.swf 2.3 MB
Games/Sapphire Room Escape.swf 2.3 MB
Games/christmasrunner.swf 2.3 MB
Games/Reincarnation Series/Reincarnation A Hillbilly Holiday.swf 2.3 MB
Games/ClickPLAY series/Clickplay 2.swf 2.3 MB
Games/The Railway Robots Road Trip.swf 2.3 MB
Games/I Remain.swf 2.2 MB
Games/awesome_happy_heroes.swf 2.2 MB
Games/alienbottlebuccaneer.swf 2.2 MB
Games/BLOCnog.swf 2.2 MB
Games/Sift Heads Series/Sift Heads 0.swf 2.2 MB
Games/The Great Basement Escape.swf 2.2 MB
Games/Bummin' A Ride.swf 2.2 MB
Games/Steppenwolf Series/steppenwolf_chapter_6_episode_3.swf 2.2 MB
Games/One Button Bob.swf 2.2 MB
Games/shapefold2.swf 2.2 MB
Games/Understanding Games Episode 3.swf 2.2 MB
Games/adventuresofveronicawright.swf 2.2 MB
Games/simplemotions2.swf 2.2 MB
Games/wasabi.swf 2.2 MB
Games/Reincarnation Series/Reincarnation Bloody Bayou.swf 2.2 MB
Games/wormmadness.swf 2.2 MB
Games/frustrabit.swf 2.2 MB
Games/Ragdoll Cannon Series/ragdollcannonlevelpack.swf 2.2 MB
Games/the sniper.swf 2.2 MB
Games/The Sagittarian Series/The Sagittarian.swf 2.2 MB
Games/the_i_of_it.swf 2.2 MB
Games/Steppenwolf Series/steppenwolf_chapter_6_episode_2.swf 2.2 MB
Games/SAS Zombie Assault.swf 2.1 MB
Games/Quick Quests.swf 2.1 MB
Games/Creative Kill Chamber Two!.swf 2.1 MB
Games/papertrain.swf 2.1 MB
Games/shameless_clone.swf 2.1 MB
Games/miningtruck.swf 2.1 MB
Games/newspaper_boy.swf 2.1 MB
Games/Wake Up the Box Series/wakeupthebox2.swf 2.1 MB
Games/Adventure Al.swf 2.1 MB
Games/60 seconds Santa Run.swf 2.1 MB
Games/The Elephant Collection/Achievement Unlocked 3.swf 2.1 MB
Games/defend your nuts.swf 2.1 MB
Games/defend-your-nuts.swf 2.1 MB
Games/dogfight.swf 2.1 MB
Games/Burger Cat.swf 2.1 MB
Games/zombierumble.swf 2.1 MB
Games/bush royal rampage.swf 2.1 MB
Games/easyjoe2.swf 2.1 MB
Games/creative_kill_chamber.swf 2.1 MB
Games/yo-ho-hocannon.swf 2.1 MB
Games/Steppenwolf Series/steppenwolf_chapter_5_episode_4.swf 2.1 MB
Games/Dog FightThe Ultimate War.swf 2.1 MB
Games/Crop Defenders.swf 2.1 MB
Games/avatar_elemental_escape.swf 2.0 MB
Games/Deadly Venom.swf 2.0 MB
Games/Steppenwolf Series/steppenwolf_chapter_5_episode_2.swf 2.0 MB
Games/Monsterland Series/monsterland. junior vs senior.swf 2.0 MB
Games/Whack Series/whack_your_boss.swf 2.0 MB
Games/kingstory.swf 2.0 MB
Games/Sweet Drmzzz.swf 2.0 MB
Games/holiday_sim.swf 2.0 MB
Games/airbattle.swf 2.0 MB
Games/Adventurous Eric.swf 2.0 MB
Games/fallenfromthemoon.swf 2.0 MB
Games/Ninjufo.swf 2.0 MB
Games/Arcane The Stone Circle Series/Arcane The Stone Circle - Episode 7.swf 2.0 MB
Games/nevermore_2.swf 2.0 MB
Games/the-day.swf 2.0 MB
Games/Infectonator Series/infectonatorwd.swf 2.0 MB
Games/Number Ninjas.swf 2.0 MB
Games/Mutant Alien Assault.swf 2.0 MB
Games/Click The Frog.swf 2.0 MB
Games/tobesgreatescape.swf 2.0 MB
Games/Steppenwolf Series/steppenwolf_chapter_1_episode_3.swf 2.0 MB
Games/bush shoot-out.swf 2.0 MB
Games/farm_express_2.swf 2.0 MB
Games/Looming.swf 1.9 MB
Games/alien hominid.swf 1.9 MB
Games/BoxHead Series/boxhead_2play.swf 1.9 MB
Games/Arcane The Stone Circle Series/Arcane The Stone Circle - Episode 6.swf 1.9 MB
Games/Sift Heads Series/sift_heads_3.swf 1.9 MB
Games/the_power_of_love.swf 1.9 MB
Games/where`re my bunnies.swf 1.9 MB
Games/Shift Series/SHIFT 2.swf 1.9 MB
Games/Steppenwolf Series/steppenwolf_chapter_5_episode_1.swf 1.9 MB
Games/Fireboy & Watergirl Series/fireboy & watergirl in the_forest_temple_3.swf 1.9 MB
Games/Thing-Thing Series/thing-thing_2.swf 1.9 MB
Games/Lucass Quest Backwards.swf 1.9 MB
Games/rocketsanta.swf 1.9 MB
Games/dead_drunk.swf 1.9 MB
Games/rocket santa.swf 1.9 MB
Games/how_to_raise_a_dragon.swf 1.9 MB
Games/gunblood.swf 1.9 MB
Games/abducted.swf 1.9 MB
Games/Arcane The Stone Circle Series/Arcane The Stone Circle - Episode 4.swf 1.9 MB
Games/Steppenwolf Series/steppenwolf_chapter_2_episode_4.swf 1.9 MB
Games/Wake Up the Box Series/wake_up_the_box_4.swf 1.9 MB
Games/the great living room escape.swf 1.9 MB
Games/Crow in Hell Series/a crow in hell 2.swf 1.9 MB
Games/Zombie Invaders.swf 1.9 MB
Games/Menulis.swf 1.9 MB
Games/angelofthebattlefield.swf 1.9 MB
Games/BoxHead Series/boxhead_the_rooms.swf 1.9 MB
Games/angrybee.swf 1.9 MB
Games/Steppenwolf Series/steppenwolf_chapter_5_episode_3.swf 1.9 MB
Games/The Elephant Collection/this-is-the-only-level-too.swf 1.9 MB
Games/Hambo 2 Hambtouchables.swf 1.9 MB
Games/Fireboy & Watergirl Series/fireboy & watergirl in the forest temple.swf 1.9 MB
Games/Despair.swf 1.9 MB
Games/Enigma.swf 1.8 MB
Games/workingstiffs.swf 1.8 MB
Games/Boss Battle.swf 1.8 MB
Games/the miller estate/EPISODE4FIXED.swf 1.8 MB
Games/icarus-needs.swf 1.8 MB
Games/Achilles.swf 1.8 MB
Games/Ninja Glove.swf 1.8 MB
Games/Steppenwolf Series/steppenwolf_chapter_3_episode_1.swf 1.8 MB
Games/Steppenwolf Series/steppenwolf_chapter_4_episode_3.swf 1.8 MB
Games/Up Down Ready.swf 1.8 MB
Games/Steppenwolf Series/steppenwolf_chapter_3_episode_2.swf 1.8 MB
Games/nextplease.swf 1.8 MB
Games/i-saw-her-standing-there.swf 1.8 MB
Games/Steppenwolf Series/steppenwolf_chapter_4_episode_4.swf 1.8 MB
Games/Madness Series/Madness Retaliation.swf 1.8 MB
Games/The Elephant Collection/this-is-the-only-level 3.swf 1.8 MB
Games/no_time_to_explain.swf 1.8 MB
Games/the mechanicer.swf 1.8 MB
Games/Flood Runner Series/the flood runner 2.swf 1.7 MB
Games/Steppenwolf Series/steppenwolf_chapter_4_episode_1.swf 1.7 MB
Games/Parallel Platformer.swf 1.7 MB
Games/accurate_slapshot_level_pack.swf 1.7 MB
Games/Daymare Series/daymare_kite.swf 1.7 MB
Games/Ghostly Me.swf 1.7 MB
Games/The Fancy Pants Adventure World Series/The fancy_pants_adventure_world_1.swf 1.7 MB
Games/Whack Series/whack_your_soul_mate.swf 1.7 MB
Games/flaming_zombooka.swf 1.7 MB
Games/Steppenwolf Series/steppenwolf_chapter_4_episode_2.swf 1.7 MB
Games/Steppenwolf Series/steppenwolf_chapter_1_episode_2.swf 1.7 MB
Games/Daymare Series/DayMare Town 2.swf 1.7 MB
Games/roundworld.swf 1.7 MB
Games/Steppenwolf Series/steppenwolf_chapter_3_episode_3.swf 1.7 MB
Games/zombie_land.swf 1.7 MB
Games/topsyturvy.swf 1.6 MB
Games/Steppenwolf Series/steppenwolf_chapter_2_episode_3.swf 1.6 MB
Games/accurate_slapshot.swf 1.6 MB
Games/Steppenwolf Series/steppenwolf_chapter_2_episode_2.swf 1.6 MB
Games/Steppenwolf Series/steppenwolf_chapter_3_episode_4.swf 1.6 MB
Games/Steppenwolf Series/steppenwolf_chapter_1_episode_4.swf 1.6 MB
Games/Submachine Series/Submachine 1 the basement.swf 1.6 MB
Games/pixelcityskater.swf 1.6 MB
Games/Steppenwolf Series/steppenwolf_chapter_1_episode_1.swf 1.6 MB
Games/Slimey's Quest.swf 1.6 MB
Games/Cat in Japan.swf 1.6 MB
Games/Steppenwolf Series/steppenwolf_chapter_2_episode_1.swf 1.6 MB
Games/onomastica2.swf 1.6 MB
Games/whiterandom.swf 1.6 MB
Games/Mothball Series/mr mothball 5.swf 1.6 MB
Games/Arcane The Stone Circle Series/Arcane The Stone Circle - Episode 1.swf 1.6 MB
Games/Zombie Crypt 3.swf 1.5 MB
Games/the miller estate/the_miller_estate.swf 1.5 MB
Games/gunrox_gang_wars.swf 1.5 MB
Games/Zombie Crypt 2.swf 1.5 MB
Games/40xEscape.swf 1.5 MB
Games/Arcane The Stone Circle Series/Arcane The Stone Circle - Episode 2.swf 1.5 MB
Games/Arcane The Stone Circle Series/Arcane The Stone Circle - Episode 3.swf 1.5 MB
Games/agentturnright.swf 1.5 MB
Games/cursed_winds.swf 1.5 MB
Games/Daymare Series/DayMare Town.swf 1.5 MB
Games/run_1.swf 1.5 MB
Games/Andrew the Droid.swf 1.5 MB
Games/ClueSweeper.swf 1.5 MB
Games/Riddle School Series/riddle_school_2.swf 1.5 MB
Games/Gravity Master.swf 1.5 MB
Games/savethefallen.swf 1.5 MB
Games/Super Stacker 2.swf 1.5 MB
Games/SeppuKuties.swf 1.5 MB
Games/Ragdoll Cannon Series/Ragdoll Cannon 1.5.swf 1.5 MB
Games/orpheus.swf 1.4 MB
Games/5 Differences.swf 1.4 MB
Games/hitthetroll.swf 1.4 MB
Games/smile_pixel.swf 1.4 MB
Games/Arcane The Stone Circle Series/Arcane The Stone Circle - Episode 5.swf 1.4 MB
Games/Hello Worlds!.swf 1.4 MB
Games/superpig.swf 1.4 MB
Games/Submachine Series/Submachine 0 the ancient adventure.swf 1.4 MB
Games/Pretentious Game Series/Pretentious Game 2.swf 1.4 MB
Games/live2work.swf 1.4 MB
Games/isoballx1.swf 1.4 MB
Games/Bloons Series/Bloons Tower Defense 3.swf 1.4 MB
Games/The Square.swf 1.4 MB
Games/screwthenut.swf 1.4 MB
Games/The Great Kitchen Escape.swf 1.4 MB
Games/bravekings.swf 1.4 MB
Games/Splat.swf 1.4 MB
Games/siftx-mess.swf 1.4 MB
Games/gravity duck 2.swf 1.4 MB
Games/Tumble Waiter.swf 1.4 MB
Games/splitterpals.swf 1.4 MB
Games/feedfreddy.swf 1.4 MB
Games/Dusk 2.swf 1.4 MB
Games/fatslice2.swf 1.4 MB
Games/Momentum_master.swf 1.3 MB
Games/dual_color_fairy.swf 1.3 MB
Games/haunted_house.swf 1.3 MB
Games/slime_laboratory_2.swf 1.3 MB
Games/red remover player pack.swf 1.3 MB
Games/slime-laboratory.swf 1.3 MB
Games/Little Fins.swf 1.3 MB
Games/I Was Hungry But There Were Cannons.swf 1.3 MB
Games/The Elephant Collection/This_is_the_only_level.swf 1.3 MB
Games/Nodes.swf 1.3 MB
Games/ending.swf 1.3 MB
Games/hole_in_the_wall_-_twisted_figures.swf 1.3 MB
Games/letitslide.swf 1.3 MB
Games/Ragdoll Cannon Series/Ragdoll Cannon Remake.swf 1.3 MB
Games/down_is_up.swf 1.3 MB
Games/SOPAPIPA.swf 1.3 MB
Games/dudeandzombies.swf 1.3 MB
Games/agent-b10-2.swf 1.3 MB
Games/pigscanfly.swf 1.3 MB
Games/unperfect.swf 1.3 MB
Games/Crow in Hell Series/a crow in hell.swf 1.3 MB
Games/Reincarnation Series/Reincarnation Out to Sea You Die.swf 1.3 MB
Games/Nightmares The Adventures Series/nightmares_the adventures 2 - Who Wants To Frame Hairy De Bully.swf 1.3 MB
Games/Darkness 2.swf 1.3 MB
Games/zombie_crypt.swf 1.3 MB
Games/Alien Exterminator.swf 1.3 MB
Games/DUI.swf 1.3 MB
Games/stealth_hunter.swf 1.3 MB
Games/floodfill.swf 1.2 MB
Games/Whack Series/whack_your_pc.swf 1.2 MB
Games/Wizard's Run.swf 1.2 MB
Games/splitman.swf 1.2 MB
Games/Nightmares The Adventures Series/nightmares_the_adventures_3_the_baron_of_vermin_famine.swf 1.2 MB
Games/Aequilibrium Series/Aequilibrium.swf 1.2 MB
Games/Water Werks.swf 1.2 MB
Games/Where is series/where_is_2014.swf 1.2 MB
Games/gingerbread_circus.swf 1.2 MB
Games/Where is series/Where is 2010.swf 1.2 MB
Games/coign of vantage.swf 1.2 MB
Games/Nightmares The Adventures Series/nightmares_the_adventures_1_broken_bones_complaint.swf 1.2 MB
Games/Escher.swf 1.2 MB
Games/stackopolis.swf 1.2 MB
Games/missingmechanism.swf 1.2 MB
Games/outlawjack.swf 1.2 MB
Games/Sky Island.swf 1.2 MB
Games/catsastronauts.swf 1.2 MB
Games/pixelquest.swf 1.2 MB
Games/alienfamily.swf 1.2 MB
Games/doors2.swf 1.2 MB
Games/gluey2.swf 1.2 MB
Games/nob_war_the_elves.swf 1.2 MB
Games/Super Crazy Guitar Maniac Deluxe Series/super_crazy_guitar_maniac_deluxe.swf 1.2 MB
Games/Ricochet Kills Series/ricochet kills players pack.swf 1.2 MB
Games/princess_rescue.swf 1.2 MB
Games/candyconveyor.swf 1.2 MB
Games/Zombie Crypt.swf 1.2 MB
Games/gravitypop.swf 1.2 MB
Games/Ricochet Kills Series/Ricochet Kills 2.swf 1.2 MB
Games/jellycannon.swf 1.2 MB
Games/Ballooner New Adventures.swf 1.2 MB
Games/Sprout.swf 1.2 MB
Games/colliderix.swf 1.2 MB
Games/Ballooner.swf 1.1 MB
Games/The Great Minimum.swf 1.1 MB
Games/Pieces.swf 1.1 MB
Games/redremoverplayerpack2.swf 1.1 MB
Games/Gravity Duck.swf 1.1 MB
Games/littlesheep.swf 1.1 MB
Games/redremover.swf 1.1 MB
Games/agent-b10.swf 1.1 MB
Games/Sugar, Sugar 3.swf 1.1 MB
Games/thanksforplaying.swf 1.1 MB
Games/Pretentious Game Series/pretentiousgame.swf 1.1 MB
Games/koutack.swf 1.1 MB
Games/rabbitwantscake.swf 1.1 MB
Games/Go Usagi Go.swf 1.1 MB
Games/humbug.swf 1.1 MB
Games/alienskidnappedbetty.swf 1.1 MB
Games/shapefold.swf 1.1 MB
Games/Hanna in a Choppa.swf 1.1 MB
Games/morphing.swf 1.1 MB
Games/castle cat 2.swf 1.0 MB
Games/Infectonator Series/infectonator_xmas.swf 1.0 MB
Games/albertthealien.swf 1.0 MB
Games/doors 3 - locked out.swf 1.0 MB
Games/Shift Series/SHIFT 3.swf 1.0 MB
Games/the miller estate/the_miller_estate_2.swf 1.0 MB
Games/werebox.swf 1.0 MB
Games/N game.swf 1.0 MB
Games/spaceiskey.swf 1.0 MB
Games/govirus.swf 1.0 MB
Games/smokinbarrels.swf 1.0 MB
Games/friendlywormholes.swf 1.0 MB
Games/Numz.swf 1.0 MB
Games/treasure_of_cutlass_reef.swf 998.2 kB
Games/Chromatic.swf 997.2 kB
Games/dupligon.swf 997.1 kB
Games/go go plant.swf 994.4 kB
Games/easyjoe3.swf 993.8 kB
Games/Pyro.swf 991.0 kB
Games/Ragdoll Cannon Series/ragdollcannon.swf 989.4 kB
Games/Rotate & Roll Players Pack.swf 985.9 kB
Games/Aequilibrium Series/Aequilibrium 4.swf 981.5 kB
Games/superstrikeofrage.swf 977.6 kB
Games/Gangster Bros.swf 976.3 kB
Games/Mothball Series/mr mothball 2.swf 974.0 kB
Games/ClickPLAY series/clickplaytime-3.swf 973.7 kB
Games/chess_strategy.swf 973.3 kB
Games/escape_the_phone_booth.swf 972.7 kB
Games/StarShine 2.swf 971.0 kB
Games/Ghosts Stole My Puppy.swf 965.5 kB
Games/The Elephant Collection/Obey the Game.swf 961.4 kB
Games/zabaax.swf 960.4 kB
Games/briker.swf 959.7 kB
Games/hack_slash_crawl.swf 959.4 kB
Games/Survivor115.swf 958.0 kB
Games/Where is series/where_is_2009.swf 957.0 kB
Games/monster_mowdown.swf 954.9 kB
Games/doors - daves free lessons.swf 953.1 kB
Games/Panda Star.swf 951.2 kB
Games/colortheory.swf 950.4 kB
Games/lostars.swf 949.1 kB
Games/dark_cut.swf 948.7 kB
Games/ninja_rampage.swf 947.9 kB
Games/the miller estate/EPISODE3.swf 946.9 kB
Games/burglar_hunt.swf 946.9 kB
Games/Mothball Series/mr mothball.swf 946.2 kB
Games/mega_miner.swf 946.0 kB
Games/Rotate & Roll.swf 933.3 kB
Games/nevermore.swf 931.8 kB
Games/higher.swf 925.0 kB
Games/divide.swf 924.3 kB
Games/peterthepenguin.swf 924.2 kB
Games/lightmyfire.swf 923.2 kB
Games/prince_and_princess_elope.swf 920.0 kB
Games/Tactics 100 Live.swf 919.7 kB
Games/mustescapetheisland.swf 919.0 kB
Games/bounzy.swf 913.9 kB
Games/run_2.swf 912.4 kB
Games/Sugar_Sugar_2.swf 911.6 kB
Games/easyjoe4.swf 910.4 kB
Games/simplemotions.swf 909.4 kB
Games/The Majesty of Colors.swf 908.6 kB
Games/littleloki.swf 897.9 kB
Games/ClickPLAY series/ClickPLAY!.swf 886.3 kB
Games/sugar_sugar.swf 880.7 kB
Games/Hitstick Series/Hitstick. Silence is over.swf 879.7 kB
Games/learn_to_fly.swf 874.3 kB
Games/Dojo of Death.swf 844.7 kB
Games/Wake Up the Box Series/wakeupthebox.swf 844.5 kB
Games/Spy.swf 812.8 kB
Games/Discovery.swf 808.7 kB
Games/hambo.swf 803.7 kB
Games/Aequilibrium Series/aequilibrium3.swf 802.7 kB
Games/easyjoe.swf 802.4 kB
Games/Bloons Series/Bloons Tower Defense 2.swf 785.9 kB
Games/Aequilibrium Series/Aequilibrium2.swf 776.9 kB
Games/Ricochet Kills Series/Ricochet Kills.swf 765.3 kB
Games/Cuboy Series/Cuboy Quest.swf 762.2 kB
Games/Take Something Literally 2.swf 759.3 kB
Games/Infectonator Series/infectonator.swf 750.3 kB
Games/Color Carnage.swf 748.3 kB
Games/Zombie Bites.swf 746.6 kB
Games/the_worlds_hardest_game.swf 744.1 kB
Games/Shadez The Black Operations.swf 708.7 kB
Games/onomastica.swf 703.6 kB
Games/I wish I were the Moon.swf 696.2 kB
Games/BoxHead Series/Boxhead - A Halloween Special.swf 693.4 kB
Games/Ricochet Kills Series/ricochet war.swf 690.2 kB
Games/Mothball Series/mr mothball 4.swf 681.0 kB
Games/Bloons Series/Bloons Pop Three.swf 659.9 kB
Games/Bongo Boom Battlegrounds.swf 648.0 kB
Games/Thing-Thing Series/Thing-Thing.swf 641.5 kB
Games/Riddle School Series/riddle_school.swf 627.6 kB
Games/Bazooka Boy Series/Bazooka Boy.swf 615.5 kB
Games/Bazooka Boy Series/Bazooka Boy Level Pack.swf 614.9 kB
Games/Doors. Out of office.swf 610.2 kB
Games/Talesworth Adventure Ep. 1.swf 589.5 kB
Games/The irRegularGame of Life.swf 582.2 kB
Games/a duck has an adventure.swf 575.5 kB
Games/Clockwork Cat.swf 555.1 kB
Games/And Everything Started to Fall.swf 537.4 kB
Games/Nano Ninja.swf 535.0 kB
Games/Bloons Series/Bloons Tower Defense.swf 530.8 kB
Games/Bloons Series/Bloons.swf 522.0 kB
Games/Bloons Series/bloons_player_pack_2.swf 518.6 kB
Games/Bloons Series/bloons_player_pack_1.swf 512.5 kB
Games/Flood Runner Series/the Flood Runner.swf 461.0 kB
Games/Bloons Series/Bloons Player Pack 5.swf 452.1 kB
Games/Bloons Series/Bloons Player Pack 4.swf 435.0 kB
Games/the miller estate/INTRODUCTION.swf 430.9 kB
Games/TETRIS'D The Game.swf 427.5 kB
Games/Blosics.swf 413.5 kB
Games/starshine.swf 378.2 kB
Games/Take Something Literally.swf 366.1 kB
Games/Mothball Series/mr mothball 3.swf 345.1 kB
Games/Fat Slice.swf 283.1 kB
Games/Daymare Series/Daymare Invaders.swf 282.9 kB
Games/Shift Series/SHIFT.swf 244.3 kB
Games/Vox Populi Vox Dei(a werewolf thriller).swf 235.0 kB
Games/Monster Match.swf 168.3 kB
Games/Tealy Orangey.swf 141.3 kB
Games/Orbox B.swf 84.4 kB
Games/Game in Ten Seconds.swf 70.8 kB
Games/faze.swf 67.5 kB
Games/The Linear RPG.swf 65.5 kB
Games/loops of zen.swf 36.5 kB
Games/Bouboum.swf 17.0 kB

==查看完整文档列表==

下一个：第一会所@yp007go@DrLomp 1.0 GB

24小时热门磁力链接

本周热门磁力链接

种子标签

种子评价

优质的种子 (0) 假种子 (0) 有密码 (0) 低质量 (0) 有病毒 (0) 无法下载 (0)
欢迎对种子质量进行评价。

人气女优

北川ゆい Akira COCOLO Saiko あいだももあさのくるみあまいれもんいしかわ愛里いとうしいなうさみ恭香うちだまひろかぐやひめかとりこのみかないかほくすのき琴美クミコグレースくらもとまい（葉月ありさ）さとみ中村あみしいな純菜しのざきさとみ（三沢亜也）牧本千幸（つかもと友希）眞木ありさデヴィテラパトリックドミニカともさかまいともさか愛なごみもえひなこ

分享BT种子/磁力链接

亲，你知道吗？下载的人越多速度越快，赶快把本页面分享给好友一起下载吧^_^

磁力管家